Transcription Factor

Accessions: T093330_1.02 (CISBP 1.02), VENTX (HT-SELEX2 May2017), O95231 (JASPAR 2024)
Names: T093330_1.02;, VENTX, ENSG00000151650, Homeobox protein VENTX, VENT homeobox homolog, VENT-like homeobox protein 2, VENTX_HUMAN
Organisms: Homo sapiens
Libraries: CISBP 1.02 1, HT-SELEX2 May2017 2, JASPAR 2024 3
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:Homeodomain, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 258
Pfam Domains: 93-148 Homeobox domain
Sequence:
(in bold interface residues)
1 MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQA 60
61 VSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE 120
121 RKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGL 180
181 QLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPA 240
241 LSTGPRGLCAMPQTGDAF
Interface Residues: 91, 92, 93, 94, 95, 133, 134, 136, 137, 140, 141, 143, 144, 145, 148
3D-footprint Homologues: 1nk2_P, 8ejp_B, 6m3d_C, 3lnq_A, 1zq3_P, 8pmf_A, 3rkq_B, 2lkx_A, 1jgg_B, 7q3o_C, 6es3_K, 5zfz_A, 4j19_B, 1puf_B, 8osb_E, 1au7_A, 5flv_I, 2ld5_A, 1fjl_B, 5zjt_E, 3a01_E, 7psx_B, 1b72_A, 5hod_A, 8eml_B, 1ig7_A, 6a8r_A, 3cmy_A, 2hdd_A, 9b8u_A, 5jlw_D, 4cyc_A, 2r5y_A, 1puf_A, 8ik5_C, 4xrs_G, 3d1n_M, 2hos_A, 1e3o_C, 2xsd_C, 1le8_A, 7xrc_C, 1k61_B, 4qtr_D, 1o4x_A, 4xrm_B, 1le8_B, 1du0_A, 1mnm_C
Binding Motifs: MA0724.1 AmCrATTAr
M0896_1.02 TTAATTAg
VENTX_2 CgATTAdCG
VENTX_3 sgyaATTAgy
VENTX_methyl_1 ygymATTAry
Publications: Noyes M.B, Christensen R.G, Wakabayashi A, Stormo G.D, Brodsky M.H, Wolfe S.A. Analysis of homeodomain specificities allows the family-wide prediction of preferred recognition sites. Cell 133:1277-89 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.