Transcription Factor

Accessions: T000577_1.02 (CISBP 1.02), Q9LND1 (JASPAR 2024)
Names: ORA59, T000577_1.02;, ERF94_ARATH, Ethylene-responsive transcription factor ERF094, Protein OCTADECANOID-RESPONSIVE ARABIDOPSIS AP2/ERF 59
Organisms: Arabidopsis thaliana
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:AP2
Length: 244
Pfam Domains: 81-131 AP2 domain
Sequence:
(in bold interface residues)
1 MEYQTNFLSGEFSPENSSSSSWSSQESFLWEESFLHQSFDQSFLLSSPTDNYCDDFFAFE 60
61 SSIIKEEGKEATVAAEEEEKSYRGVRKRPWGKFAAEIRDSTRKGIRVWLGTFDTAEAAAL 120
121 AYDQAAFALKGSLAVLNFPADVVEESLRKMENVNLNDGESPVIALKRKHSMRNRPRGKKK 180
181 SSSSSTLTSSPSSSSSYSSSSSSSSLSSRSRKQSVVMTQESNTTLVVLEDLGAEYLEELM 240
241 RSCS
Interface Residues: 86, 88, 90, 94, 96, 98, 106, 108
3D-footprint Homologues: 7wq5_A, 1gcc_A, 5wx9_A
Binding Motifs: M0005_1.02 mGCCGCCg
MA1049.1 mGCCGCCg
MA1049.2 mGCCGCC
Publications: Magnani E, Sjölander K, Hake S. From endonucleases to transcription factors: evolution of the AP2 DNA binding domain in plants. Plant Cell 16:2265-77 (2004). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.