Transcription Factor

Accessions: 1xsd_A (3D-footprint 20241219)
Names: Beta-lactamase repressor protein, BLAI_STAAU, penicillinase repressor, Regulatory protein BlaI
Organisms: Staphylococcus aureus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0A042
Length: 125
Pfam Domains: 7-64 MarR family
7-120 Penicillinase repressor
Sequence:
(in bold interface residues)
1 TNKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRY 60
61 KSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILN 120
121 DISKK
Interface Residues: 42, 43, 45, 46, 47, 50
3D-footprint Homologues: 1sax_A, 1xsd_A
Binding Motifs: 1xsd_A TGTAgt
Binding Sites: 1xsd_B
Publications: Safo M.K, Zhao Q, Ko T.P, Musayev F.N, Robinson H, Scarsdale N, Wang A.H, Archer G.L. Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons. Journal of bacteriology 187:1833-44 (2005). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.