Transcription Factor
| Accessions: | T073816_1.02 (CISBP 1.02), T15201 (AthalianaCistrome v4_May2016), Q8L548 (JASPAR 2024) |
| Names: | SOL1, T073816_1.02;, AT3G22760, T15201;, AtTCX3, Protein SOL1, Protein tesmin/TSO1-like CXC 3, Protein TSO1-like 1, TCX3_ARATH |
| Organisms: | Arabidopsis thaliana |
| Libraries: | CISBP 1.02 1, AthalianaCistrome v4_May2016 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:CxC, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:CPP |
| Length: | 609 |
| Pfam Domains: | 326-364 Tesmin/TSO1-like CXC domain 411-449 Tesmin/TSO1-like CXC domain |
| Sequence: | MDTPEKSETQIGTPVSKLKVEDSPVFSYICNLSPIKTIKPIPITCPLSSLNYASPPSVFT SPHAVSHKESRFRSQKDVSASKEVGEEEALVGSEPEQSYKNDCNTPRVTNDVKDNGCGKD LQVMMDNVKKKSDTPDWETLIAATTELIYGSPRESEAFSCLLKKTSNSEARLRGSITATS VAVTNTDVVNNESESVDALSILHRGVRRRCLDFEVKGNNQQTLGESSSSCVVPSIGLHLN TIAMSSKDKNVANEYSFSGNIKVGVQSSLTPVLHSQHDIVRENESGKDSGQIIEVVPKSL ASVDLTPISPKKKRRKSEQSGEGDSSCKRCNCKKSKCLKLYCECFAAGFYCIEPCSCINC FNKPIHKDVVLATRKQIESRNPLAFAPKVIRNSDSIIEVGEDASKTPASARHKRGCNCKK SNCLKKYCECYQGGVGCSINCRCEGCKNAFGRKDGSLFEQDEENETSGTPGTKKTQQNVE LFKPAAPPSTPIPFRQPLAQLPISSNNRLLPPQSHFHHGAIGSSSSGIYNIRKPDMSLLS HSRIETITEDIDDMSENLIHSPITTLSPNSKRVSLSHLDSPESTPWRRNGGGRNLIRSFP TFPSLTPHH |
| Binding Motifs: | M0590_1.02 rTTTrAAw M0357 wTwwAAAATTYAAAw M0356 awTTyrAATTTbAAa MA1682.1 wwAAATTCAAATww MA1682.2 AAATTCAAATww |
| Binding Sites: | MA1682.1.1 MA1682.1.10 MA1682.1.11 / MA1682.1.9 MA1682.1.10 / MA1682.1.12 MA1682.1.13 MA1682.1.11 / MA1682.1.14 MA1682.1.12 / MA1682.1.15 MA1682.1.13 / MA1682.1.16 MA1682.1.14 / MA1682.1.17 MA1682.1.15 / MA1682.1.18 MA1682.1.16 / MA1682.1.19 MA1682.1.2 MA1682.1.17 / MA1682.1.20 MA1682.1.3 MA1682.1.4 MA1682.1.5 MA1682.1.6 MA1682.1.7 MA1682.1.7 / MA1682.1.8 MA1682.1.8 / MA1682.1.9 MA1682.1.18 MA1682.1.19 MA1682.1.20 MA1682.1.4 MA1682.2.1 MA1682.2.10 MA1682.2.11 / MA1682.2.19 MA1682.2.12 MA1682.2.13 / MA1682.2.6 MA1682.2.14 MA1682.2.15 MA1682.2.16 MA1682.2.17 / MA1682.2.5 MA1682.2.18 MA1682.2.2 MA1682.2.20 MA1682.2.3 MA1682.2.4 MA1682.2.7 MA1682.2.8 MA1682.2.9 |
| Publications: | Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.