Transcription Factor
Accessions: | 1bc7_C (3D-footprint 20241219), 1bc8_C (3D-footprint 20241219) |
Names: | ELK4_HUMAN, ETS domain-containing protein Elk-4, ETS-DOMAIN PROTEIN, SAP-1, Serum response factor accessory protein 1, SRF accessory protein 1, SAP-1 ETS DOMAIN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P28324 |
Length: | 93 |
Pfam Domains: | 5-86 Ets-domain |
Sequence: (in bold interface residues) | 1 MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLS 60 61 RALRYYYVKNIIKKVNGQKFVYKFVSYPEILNM |
Interface Residues: | 57, 58, 61, 62, 64, 65, 79 |
3D-footprint Homologues: | 8smh_F, 8smj_F, 7jsa_J, 8ee9_F, 1yo5_C |
Binding Motifs: | 1bc7_C cATCCt 1bc8_C CGGAa |
Binding Sites: | 1bc8_A 1bc7_A 1bc7_B 1bc8_B |
Publications: | Mo Y., Vaessen B., Johnston K., Marmorstein R. Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.. Mol. Cell 2:201-212 (1998). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.