Transcription Factor

Accessions: 6fqp_B (3D-footprint 20250804)
Names: 5'-TG-3'-interacting factor 1, Homeobox protein TGIF1, TGIF1_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q15583
Length: 66
Pfam Domains: 2-58 Homeobox domain
19-58 Homeobox KN domain
Sequence:
(in bold interface residues)
1 KRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLL 60
61 PDMLRK
Interface Residues: 2, 3, 4, 5, 49, 50, 53, 54, 55, 57, 58
3D-footprint Homologues: 6fqp_B, 1zq3_P, 1puf_B, 1le8_A, 4j19_B, 1du0_A, 1le8_B, 6fqq_E, 2d5v_B, 1fjl_B, 4xrm_B, 1mnm_C, 7psx_B, 2hdd_A, 1k61_B, 5zjt_E, 2hos_A
Binding Motifs: 6fqp_AB TGACAgCtGTCA
6fqp_B ctGTCA
Binding Sites: 6fqp_L / 6fqp_M
Publications: Guca E, Suñol D, Ruiz L, Konkol A, Cordero J, Torner C, Aragon E, Martin-Malpartida P, Riera A, Macias MJ. TGIF1 homeodomain interacts with Smad MH1 domain and represses TGF-β signaling. Nucleic Acids Res 46:9220-9235 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.