Transcription Factor

Accessions: 6jbx_A (3D-footprint 20231221)
Names: Fatty acid biosynthesis transcriptional regulator, Q8DR18_STRR6
Organisms: strain ATCC BAA-255 / R6, Streptococcus pneumoniae
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q8DR18
Length: 146
Pfam Domains: 34-91 MarR family
35-93 MarR family
41-101 Winged helix DNA-binding domain
Sequence:
(in bold interface residues)
1 HHMDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIGKAPDVTPSQVSKE 60
61 LMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLIHRLHKRFHKAMVEKII 120
121 DGMSEEEIAVMGKGLTNLYQFLEDLK
Interface Residues: 54, 55, 60, 64, 65, 66, 67, 68, 69, 70, 71, 73, 74, 91
3D-footprint Homologues: 5hlg_E, 7yoj_A, 5yi2_J, 1z9c_A, 7bhy_A, 2isz_B, 7dvv_A, 5h3r_A, 6jbx_A, 3q5f_A, 1u8r_B, 7b24_C, 4aik_A, 3zpl_B, 6c2s_C
Binding Motifs: 6jbx_A TCnaATnAT
6jbx_AB ATnnTnYgnnnnTcnnAnnAT
Binding Sites: 6jbx_C
6jbx_D
Publications: Zuo G, Chen ZP, Jiang YL, Zhu Z, Ding C, Zhang Z, Chen Y, Zhou CZ, Li Q. Structural insights into repression of the Pneumococcal fatty acid synthesis pathway by repressor FabT and co-repressor acyl-ACP. FEBS Lett 593:2730-2741 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.