Transcription Factor
| Accessions: | P46897 (JASPAR 2024), T10553 (AthalianaCistrome v4_May2016) |
| Names: | ATHB7_ARATH, HD-ZIP protein ATHB-7, Homeobox-leucine zipper protein ATHB-7, Homeodomain transcription factor ATHB-7, AT2G46680, ATHB7, T10553; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1, AthalianaCistrome v4_May2016 2 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Uniprot: | P46897 |
| Notes: | ecotype:Col-0, experiment type: DAP-seq, family:Homeobox |
| Length: | 258 |
| Pfam Domains: | 32-85 Homeobox domain 87-131 Homeobox associated leucine zipper |
| Sequence: (in bold interface residues) | 1 MTEGGEYSPAMMSAEPFLTMKKMKKSNHNKNNQRRFSDEQIKSLEMMFESETRLEPRKKV 60 61 QLARELGLQPRQVAIWFQNKRARWKSKQLETEYNILRQNYDNLASQFESLKKEKQALVSE 120 121 LQRLKEATQKKTQEEERQCSGDQAVVALSSTHHESENEENRRRKPEEVRPEMEMKDDKGH 180 181 HGVMCDHHDYEDDDNGYSNNIKREYFGGFEEEPDHLMNIVEPADSCLTSSDDWRGFKSDT 240 241 TTLLDQSSNNYPWRDFWS |
| Interface Residues: | 30, 31, 32, 33, 35, 71, 72, 74, 75, 78, 79, 81, 82, 83, 84, 85, 86 |
| 3D-footprint Homologues: | 8ejp_B, 1zq3_P, 3d1n_M, 8osb_E, 1nk2_P, 8ik5_C, 5jlw_D, 2ld5_A, 1le8_A, 1au7_A, 1ig7_A, 7q3o_C, 5zfz_A, 4cyc_A, 2lkx_A, 1puf_A, 1b72_A, 5flv_I, 2hdd_A, 1jgg_B, 8bx1_A, 5zjt_E, 4qtr_D, 2r5y_A, 1puf_B, 1du0_A, 6wig_A, 5hod_A, 3lnq_A, 6a8r_A, 4xrm_B, 3a01_E, 8pmf_A, 1fjl_B, 7psx_B, 3rkq_B, 8eml_B, 6es3_K, 4xrs_G, 3cmy_A, 2d5v_B, 9b8u_A, 2hos_A, 6m3d_C |
| Binding Motifs: | MA0954.1 yCAATCAWtg M0429 / MA0954.2 tcAATGATTGrwt MA0954.3 tcAATGATTGr |
| Binding Sites: | MA0954.2.1 MA0954.2.10 MA0954.2.11 MA0954.2.12 MA0954.2.13 MA0954.2.14 MA0954.2.15 MA0954.2.16 MA0954.2.17 MA0954.2.18 MA0954.2.19 MA0954.2.2 MA0954.2.20 MA0954.2.3 MA0954.2.4 MA0954.2.5 MA0954.2.6 MA0954.2.7 MA0954.2.8 MA0954.2.9 MA0954.3.1 MA0954.3.10 MA0954.3.11 MA0954.3.12 MA0954.3.13 MA0954.3.14 MA0954.3.15 MA0954.3.16 MA0954.3.17 MA0954.3.18 MA0954.3.19 MA0954.3.2 MA0954.3.20 MA0954.3.3 MA0954.3.4 MA0954.3.5 MA0954.3.6 MA0954.3.7 MA0954.3.8 MA0954.3.9 |
| Publications: | Johannesson H., Wang Y., Engstrom P. DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro. Plant Mol. Biol. 45:63-73 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.