Transcription Factor
| Accessions: | 4g92_A (3D-footprint 20250804) |
| Names: | HAPB protein, P87249_EMEND |
| Organisms: | Emericella nidulans |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P87249 |
| Length: | 61 |
| Pfam Domains: | 1-57 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B |
| Sequence: (in bold interface residues) | 1 SPLYVNAKQFHRILKRRVARQKLEEQLRLTSKGRKPYLHESRHNHAMRRPRGPGGRFLTA 60 61 D |
| Interface Residues: | 42, 45, 49, 51, 56, 57 |
| 3D-footprint Homologues: | 4g92_A, 6r2v_A, 4awl_A |
| Binding Motifs: | 4g92_A CCAATCannnnT |
| Binding Sites: | 4g92_D 4g92_E |
| Publications: | Huber E.M, Scharf D.H, Hortschansky P, Groll M, Brakhage A.A. DNA minor groove sensing and widening by the CCAAT-binding complex. Structure (London, England : 1993) 20:1757-68 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.