Transcription Factor

Accessions: 4g92_A (3D-footprint 20250804)
Names: HAPB protein, P87249_EMEND
Organisms: Emericella nidulans
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P87249
Length: 61
Pfam Domains: 1-57 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B
Sequence:
(in bold interface residues)
1 SPLYVNAKQFHRILKRRVARQKLEEQLRLTSKGRKPYLHESRHNHAMRRPRGPGGRFLTA 60
61 D
Interface Residues: 42, 45, 49, 51, 56, 57
3D-footprint Homologues: 4g92_A, 6r2v_A, 4awl_A
Binding Motifs: 4g92_A CCAATCannnnT
Binding Sites: 4g92_D
4g92_E
Publications: Huber E.M, Scharf D.H, Hortschansky P, Groll M, Brakhage A.A. DNA minor groove sensing and widening by the CCAAT-binding complex. Structure (London, England : 1993) 20:1757-68 (2012). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.