Transcription Factor

Accessions: 2me6_A (3D-footprint 20231221)
Names: Gastrulation and brain-specific homeobox protein 1, GBX1_HUMAN, Homeobox protein GBX-1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q14549
Length: 71
Pfam Domains: 8-64 Homeobox domain
Sequence:
(in bold interface residues)
1 SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA 60
61 KWKRIKAGNVS
Interface Residues: 8, 9, 10, 11, 13, 49, 50, 52, 53, 56, 57, 60, 61, 64
3D-footprint Homologues: 2h1k_B, 1puf_A, 6a8r_A, 3cmy_A, 3d1n_M, 1fjl_B, 5zfz_A, 1ig7_A, 3lnq_A, 2lkx_A, 1jgg_B, 1nk2_P, 1zq3_P, 6m3d_C, 4j19_B, 2ld5_A, 3a01_E, 7psx_B, 5hod_A, 2hdd_A, 7q3o_C, 5jlw_D, 3rkq_B, 2r5y_A, 1puf_B, 6es3_K, 1au7_A, 4xrs_G, 2hos_A, 4cyc_A, 1b72_A, 5flv_I, 3l1p_A, 5zjt_E, 1e3o_C, 7xrc_C, 2xsd_C, 1le8_A, 1le8_B, 1du0_A, 4qtr_D, 1mnm_C, 1k61_B, 1o4x_A, 8g87_X
Binding Motifs: 2me6_A aCTAATTAg
Binding Sites: 2me6_B / 2me6_C
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.