Transcription Factor
| Accessions: | SPIB_HUMAN (HOCOMOCO 10), Q01892 (JASPAR 2024) |
| Names: | SPIB_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 262 |
| Pfam Domains: | 169-253 Ets-domain |
| Sequence: (in bold interface residues) | 1 MLALEAAQLDGPHFSCLYPDGVFYDLDSCKHSSYPDSEGAPDSLWDWTVAPPVPATPYEA 60 61 FDPAAAAFSHPQAAQLCYEPPTYSPAGNLELAPSLEAPGPGLPAYPTENFASQTLVPPAY 120 121 APYPSPVLSEEEDLPLDSPALEVSDSESDEALVAGPEGKGSEAGTRKKLRLYQFLLGLLT 180 181 RGDMRECVWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLARALRNYAKTGEI 240 241 RKVKRKLTYQFDSALLPAVRRA |
| Interface Residues: | 87, 225, 226, 228, 229, 230, 232, 233, 246 |
| 3D-footprint Homologues: | 2pyl_A, 7jsa_J, 3zp5_A, 4mhg_A, 8ee9_F, 4uno_A, 2stt_A, 8smh_F, 1dux_F, 5cl8_A, 3jtg_A, 8smj_F, 1yo5_C, 1awc_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B |
| Binding Motifs: | SPIB_HUMAN.H10MO.B|M01530 arAAWsmGGAAs MA0081.1 wsmGGAA MA0081.2 tytCACTTCCTCttty MA0081.3 tCACTTCCTCttt |
| Binding Sites: | MA0081.1.1 MA0081.1.10 MA0081.1.11 MA0081.1.12 MA0081.1.13 MA0081.1.14 MA0081.1.15 MA0081.1.16 MA0081.1.17 MA0081.1.18 MA0081.1.19 MA0081.1.2 MA0081.1.20 MA0081.1.3 MA0081.1.4 MA0081.1.5 MA0081.1.6 MA0081.1.7 MA0081.1.8 MA0081.1.9 MA0081.2.1 MA0081.2.10 / MA0081.2.8 MA0081.2.11 / MA0081.2.9 MA0081.2.12 MA0081.2.10 / MA0081.2.13 MA0081.2.14 MA0081.2.15 MA0081.2.16 MA0081.2.17 MA0081.2.11 / MA0081.2.18 MA0081.2.12 / MA0081.2.19 MA0081.2.2 MA0081.2.20 MA0081.2.3 MA0081.2.4 MA0081.2.5 MA0081.2.6 MA0081.2.6 / MA0081.2.7 MA0081.2.7 / MA0081.2.8 MA0081.2.9 MA0081.2.1 MA0081.2.13 MA0081.2.14 MA0081.2.15 MA0081.2.16 MA0081.2.17 MA0081.2.18 MA0081.2.19 MA0081.2.20 MA0081.3.1 MA0081.3.10 MA0081.3.11 MA0081.3.12 MA0081.3.13 MA0081.3.14 MA0081.3.15 MA0081.3.16 MA0081.3.17 MA0081.3.18 MA0081.3.19 / MA0081.3.20 MA0081.3.2 MA0081.3.3 MA0081.3.4 MA0081.3.5 MA0081.3.6 MA0081.3.7 MA0081.3.8 MA0081.3.9 |
| Publications: | Ray-Gallet D, Mao C, Tavitian A, Moreau-Gachelin F. DNA binding specificities of Spi-1/PU.1 and Spi-B transcription factors and identification of a Spi-1/Spi-B binding site in the c-fes/c-fps promoter. Oncogene 11:303-13 (1995). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.