Transcription Factor
| Accessions: | 4tnt_A (3D-footprint 20231221), 4tnt_B (3D-footprint 20231221) |
| Names: | MCR_HUMAN, Mineralocorticoid receptor, MR, Nuclear receptor subfamily 3 group C member 2 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P08235 |
| Length: | 72 |
| Pfam Domains: | 3-70 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 SKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR 60 61 LQKCLQAGMNLG |
| Interface Residues: | 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1a6y_A, 1lo1_A, 3g9m_B, 4oln_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E |
| Binding Motifs: | 4tnt_AB GnaCannnTGnnC 4tnt_B aGnACA |
| Binding Sites: | 4tnt_D 4tnt_C |
| Publications: | Hudson W.H, Youn C, Ortlund E.A. Crystal structure of the mineralocorticoid receptor DNA binding domain in complex with DNA. PloS one 9:e107000 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.