Transcription Factor
Accessions: | Q9NVV9 (JASPAR 2024) |
Names: | THAP1_HUMAN |
Organisms: | Homo sapiens |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | Q9NVV9 |
Length: | 213 |
Pfam Domains: | 4-84 THAP domain |
Sequence: (in bold interface residues) | 1 MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTP 60 61 DCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLM 120 121 PPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKL 180 181 KEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA |
Interface Residues: | 1, 3, 24, 47, 48, 50, 51, 52, 65 |
3D-footprint Homologues: | 2ko0_A |
Binding Motifs: | MA0597.1 ytGCCMkya MA0597.2 ssgcAGGGCAss MA0597.3 gcAGGGCA |
Binding Sites: | MA0597.3.6 MA0597.3.20 MA0597.3.8 / MA0597.3.9 MA0597.1.1 MA0597.1.10 MA0597.1.11 MA0597.1.12 MA0597.1.13 MA0597.1.14 MA0597.1.15 MA0597.1.16 MA0597.1.17 MA0597.1.18 MA0597.1.19 MA0597.1.2 MA0597.1.20 MA0597.1.3 MA0597.1.4 MA0597.1.5 MA0597.1.6 MA0597.1.7 MA0597.1.8 MA0597.1.9 MA0597.2.1 MA0597.2.10 MA0597.2.11 MA0597.2.12 MA0597.2.13 MA0597.2.14 MA0597.2.15 MA0597.2.16 MA0597.2.17 MA0597.2.18 MA0597.2.19 MA0597.2.2 MA0597.2.20 MA0597.2.3 MA0597.2.4 MA0597.2.5 MA0597.2.6 MA0597.2.7 MA0597.2.8 MA0597.2.9 MA0597.3.1 / MA0597.3.10 / MA0597.3.12 / MA0597.3.13 / MA0597.3.14 / MA0597.3.17 MA0597.3.11 MA0597.3.15 MA0597.3.16 / MA0597.3.7 MA0597.3.18 / MA0597.3.3 / MA0597.3.4 MA0597.3.19 MA0597.3.2 MA0597.3.5 |
Publications: | Clouaire T, Roussigne M, Ecochard V, Mathe C, Amalric F, Girard J.P. The THAP domain of THAP1 is a large C2CH module with zinc-dependent sequence-specific DNA-binding activity. Proceedings of the National Academy of Sciences of the United States of America 102:6907-12 (2005). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.