Transcription Factor

						

			
Accessions: 5yeg_A (3D-footprint 20231221)

			
Names: 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P49711
Length: 138
Pfam Domains:      2-24 C2H2-type zinc-finger domain
     2-24 C2H2-type zinc finger
    17-38 Zinc-finger double domain
    30-53 C2H2-type zinc-finger domain
    30-52 C2H2-type zinc finger
    30-52 Zinc finger, C2H2 type
    45-69 Zinc-finger double domain
    58-81 C2H2-type zinc finger
   88-111 Zinc finger, C2H2 type
   88-111 C2H2-type zinc finger
  119-138 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 PFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYEC   60
  61 YICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKC  120
 121 RYCDAVFHERYALIQHQK
Interface Residues: 2, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 25, 40, 41, 42, 43, 44, 45, 46, 47, 48, 55, 68, 69, 70, 71, 72, 74, 75, 79, 99, 100, 101, 102, 105, 108, 129, 130, 131, 132, 135
3D-footprint Homologues: 2kmk_A, 1tf3_A, 7y3l_A, 5v3j_F, 7n5w_A, 5ei9_F, 5kl3_A, 7ysf_A, 1g2f_F, 6wmi_A, 8ssq_A, 1tf6_A, 7w1m_H, 5und_A, 2gli_A, 8ssu_A, 1ubd_C, 6ml4_A, 4x9j_A, 1mey_C, 6blw_A, 5kkq_D, 1f2i_J, 6u9q_A, 8h9h_G, 4m9v_C, 7eyi_G, 6e94_A, 2lt7_A, 2i13_A, 2jpa_A, 3uk3_C, 8cuc_F, 7txc_E, 5yj3_D, 5k5i_A, 6jnm_A, 1llm_D, 6a57_A, 8gn3_A, 2wbs_A, 7y3m_I, 1yuj_A, 2drp_D, 5yel_A, 5k5l_F
Binding Motifs: 5yeg_A CGCCCTCTGCTGG
Binding Sites: 5yeg_C
5yeg_D
			
Publications: Yin M, Wang J, Wang M, Li X, Zhang M, Wu Q, Wang Y. Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites. Cell Res 27:1365-1377 (2017). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.