Transcription Factor

Accessions: 1fjl_B (3D-footprint 20241219)
Names: PAIRED PROTEIN, PRD_DROME
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P06601
Length: 58
Pfam Domains: 2-58 Homeobox domain
25-55 Homeobox KN domain
Sequence:
(in bold interface residues)
1 QRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNRRARLRK
Interface Residues: 2, 3, 4, 5, 43, 44, 46, 47, 50, 51, 53, 54, 55, 58
3D-footprint Homologues: 8ejp_B, 8pmf_A, 1zq3_P, 6m3d_C, 2lkx_A, 2ld5_A, 8ik5_C, 7psx_B, 2hdd_A, 9b8u_A, 4cyc_A, 8osb_E, 7q3o_C, 2hos_A, 8eml_B, 6es3_K, 8pi8_B, 2h8r_B, 7xrc_C, 8g87_X, 8bx1_A
Binding Motifs: 1fjl_B GTAATcA
Binding Sites: 1fjl_D
1fjl_E
Publications: Wilson D.S, Guenther B, Desplan C, Kuriyan J. High resolution crystal structure of a paired (Pax) class cooperative homeodomain dimer on DNA. Cell 82:709-19 (1995). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.