Transcription Factor
Accessions: | 4nhj_A (3D-footprint 20231221) |
Names: | A6T8N1_KLEP7, Activator, DNA-binding transcriptional regulator RstA, OmpR family, Response regulator |
Organisms: | Klebsiella pneumoniae subsp. pneumoniae, strain ATCC 700721 / MGH 78578 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | G0GNT0 |
Length: | 102 |
Pfam Domains: | 23-99 Transcriptional regulatory protein, C terminal |
Sequence: (in bold interface residues) | 1 PHKTISFGSLTIDPVNRQVMLGGENVALSTADFDMLWELATHAGQIMDRDALLKNLRGVT 60 61 YDGMDRSVDVAISRLRKKLLDNATEPYRIKTVRNKGYLFAPH |
Interface Residues: | 65, 66, 67, 69, 70, 71, 73, 74, 93 |
3D-footprint Homologues: | 8jo2_H, 8hih_Q, 4kfc_B, 6lxn_A, 8hml_B, 4nhj_A, 7e1b_B, 5ed4_A, 2z33_A, 5x5l_H, 8b4b_W |
Binding Motifs: | 4nhj_A GAaTGTACA 4nhj_AB TGtACAnnCCGTkrCT |
Binding Sites: | 4nhj_C 4nhj_D |
Publications: | Li Y.C, Chang C.K, Chang C.F, Cheng Y.H, Fang P.J, Yu T, Chen S.C, Li Y.C, Hsiao C.D, Huang T.H. Structural dynamics of the two-component response regulator RstA in recognition of promoter DNA element. Nucleic acids research 42:8777-88 (2014). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.