Transcription Factor

Accessions: 4nhj_A (3D-footprint 20231221)
Names: A6T8N1_KLEP7, Activator, DNA-binding transcriptional regulator RstA, OmpR family, Response regulator
Organisms: Klebsiella pneumoniae subsp. pneumoniae, strain ATCC 700721 / MGH 78578
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: G0GNT0
Length: 102
Pfam Domains: 23-99 Transcriptional regulatory protein, C terminal
Sequence:
(in bold interface residues)
1 PHKTISFGSLTIDPVNRQVMLGGENVALSTADFDMLWELATHAGQIMDRDALLKNLRGVT 60
61 YDGMDRSVDVAISRLRKKLLDNATEPYRIKTVRNKGYLFAPH
Interface Residues: 65, 66, 67, 69, 70, 71, 73, 74, 93
3D-footprint Homologues: 8jo2_H, 8hih_Q, 4kfc_B, 6lxn_A, 8hml_B, 4nhj_A, 7e1b_B, 5ed4_A, 2z33_A, 5x5l_H, 8b4b_W
Binding Motifs: 4nhj_A GAaTGTACA
4nhj_AB TGtACAnnCCGTkrCT
Binding Sites: 4nhj_C
4nhj_D
Publications: Li Y.C, Chang C.K, Chang C.F, Cheng Y.H, Fang P.J, Yu T, Chen S.C, Li Y.C, Hsiao C.D, Huang T.H. Structural dynamics of the two-component response regulator RstA in recognition of promoter DNA element. Nucleic acids research 42:8777-88 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.