Transcription Factor

						

			
Accessions: 4cn3_A (3D-footprint 20231221), 6fbr_A (3D-footprint 20231221)

			
Names: Nuclear receptor subfamily 2 group B member 1, RETINOIC ACID RECEPTOR RXR-ALPHA, Retinoid X receptor alpha, RXRA_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19793
Length: 78
Pfam Domains:      4-72 Zinc finger, C4 type (two domains)
Sequence: 
(in bold interface residues)		   1 TKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYC   60
  61 RYQKCLAMGMKREAVQEE
Interface Residues: 13, 14, 16, 17, 23, 24, 26, 27, 30, 31, 55
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B
Binding Motifs: 4cn3_AD TGAACtnTGAAC
6fbr_AB TGAACnnTGACC
			
Publications: Osz J, McEwen A.G, Poussin-Courmontagne P, Moutier E, Birck C, Davidson I, Moras D, Rochel N. Structural basis of natural promoter recognition by the retinoid X nuclear receptor. Scientific reports 5:8216 (2015). [Pubmed]


Osz J, McEwen AG, Wolf J, Poussin-Courmontagne P, Peluso-Iltis C, Chebaro Y, Kieffer B, Rochel N. Modulation of RXR-DNA complex assembly by DNA context. Mol Cell Endocrinol : (2019). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.