Transcription Factor
Accessions: | RXRA_MOUSE (HOCOMOCO 10), P28700 (JASPAR 2024) |
Names: | Nuclear receptor subfamily 2 group B member 1, Retinoic acid receptor RXR-alpha, Retinoid X receptor alpha, RXRA_MOUSE |
Organisms: | Mus musculus |
Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Length: | 467 |
Pfam Domains: | 17-132 Nuclear/hormone receptor activator site AF-1 139-207 Zinc finger, C4 type (two domains) 269-447 Ligand-binding domain of nuclear hormone receptor |
Sequence: (in bold interface residues) | 1 MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSPISTLS 60 61 SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNG 120 121 VLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK 180 181 DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI 240 241 LEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD 300 301 DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS 360 361 KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF 420 421 AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT |
Interface Residues: | 149, 151, 158, 161, 162, 165, 166, 190, 212, 214, 216, 219, 221 |
3D-footprint Homologues: | 6l6q_B, 7wnh_D, 3g9m_B, 8hbm_B, 2ff0_A, 7xv6_B, 2han_A, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 2nll_B, 5cbz_E, 3g6t_A, 8rm6_A, 7prw_B, 5cbx_B |
Binding Motifs: | MA0065.2 strGGgcArAGGkcA PB0057.1 tshykTGACCCCdyrmt PB0161.1 kcrcrwAGktyrtwmk MA0512.2 grGGTCAAAGGTCA MA0494.1 TGaCCtvrrGTrACCyykg MA0512.1 CArAGKTCAgd RXRA_MOUSE.H10MO.C|M01331 rrgrtcarrAGkTCAAGGtCAk |
Binding Sites: | MA0065.2.1 MA0065.2.10 MA0065.2.11 MA0065.2.12 MA0065.2.13 MA0065.2.14 MA0065.2.15 MA0065.2.16 MA0065.2.17 MA0065.2.18 MA0065.2.19 MA0065.2.2 MA0065.2.20 MA0065.2.3 MA0065.2.4 MA0065.2.5 MA0065.2.6 MA0065.2.7 MA0065.2.8 MA0065.2.9 MA0494.1.1 MA0494.1.10 MA0494.1.11 MA0494.1.12 MA0494.1.13 MA0494.1.14 MA0494.1.15 MA0494.1.16 MA0494.1.17 MA0494.1.18 MA0494.1.19 MA0494.1.2 MA0494.1.20 MA0494.1.3 MA0494.1.4 MA0494.1.5 MA0494.1.6 MA0494.1.7 MA0494.1.8 MA0494.1.9 MA0512.1.1 MA0512.1.10 MA0512.1.11 MA0512.1.12 MA0512.1.13 MA0512.1.14 MA0512.1.15 MA0512.1.16 MA0512.1.17 MA0512.1.18 MA0512.1.19 MA0512.1.2 MA0512.1.20 MA0512.1.3 MA0512.1.4 MA0512.1.5 MA0512.1.6 MA0512.1.7 MA0512.1.8 MA0512.1.9 |
Publications: | Zhang X.-K., Lehmann J., Hoffmann B., Dawson M. I., Cameron J., Graupner G., Hermann T., Tran P., Pfahl M. Homodimer formation of retinoid X receptor induced by 9-cis retinoic acid. Nature 358:587-591 (1992). [Pubmed] Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed] Nielsen R, Pedersen T.A, Hagenbeek D, Moulos P, Siersbaek R, Megens E, Denissov S, Børgesen M, Francoijs K.J, Mandrup S, Stunnenberg H.G. Genome-wide profiling of PPARgamma:RXR and RNA polymerase II occupancy reveals temporal activation of distinct metabolic pathways and changes in RXR dimer composition during adipogenesis. Genes & development 22:2953-67 (2008). [Pubmed] Zhao Q, Chasse S.A, Devarakonda S, Sierk M.L, Ahvazi B, Rastinejad F. Structural basis of RXR-DNA interactions. Journal of molecular biology 296:509-20 (2000). [Pubmed] Shen Q, Bai Y, Chang K.C, Wang Y, Burris T.P, Freedman L.P, Thompson C.C, Nagpal S. Liver X receptor-retinoid X receptor (LXR-RXR) heterodimer cistrome reveals coordination of LXR and AP1 signaling in keratinocytes. The Journal of biological chemistry 286:14554-63 (2011). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.