Transcription Factor
| Accessions: | Q96N20 (JASPAR 2024) |
| Names: | ZN75A_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q96N20 |
| Length: | 296 |
| Pfam Domains: | 1-33 KRAB box 149-170 Zinc-finger double domain 161-183 C2H2-type zinc finger 161-183 Zinc finger, C2H2 type 161-181 C2H2-type zinc finger 176-198 Zinc-finger double domain 188-211 C2H2-type zinc finger 189-211 C2H2-type zinc finger 189-211 Zinc finger, C2H2 type 203-227 Zinc-finger double domain 216-239 C2H2-type zinc finger 217-239 C2H2-type zinc finger 217-239 Zinc finger, C2H2 type 234-255 Zinc-finger double domain 244-267 C2H2-type zinc finger 245-267 Zinc finger, C2H2 type 245-267 C2H2-type zinc finger 259-283 Zinc-finger double domain 272-295 C2H2-type zinc finger 273-295 Zinc finger, C2H2 type 273-295 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MYFSQEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPE 60 61 FKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMH 120 121 RVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQ 180 181 RIHTEEKPYKCQQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHT 240 241 GEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL |
| Interface Residues: | 150, 161, 171, 172, 173, 174, 175, 176, 177, 178, 179, 182, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 212, 227, 228, 229, 230, 231, 233, 234, 255, 256, 257, 258, 259, 261, 262, 264, 266, 267, 283, 284, 285, 286, 287, 288, 289, 290 |
| 3D-footprint Homologues: | 7w1m_H, 2kmk_A, 5v3j_F, 6jnm_A, 8ssu_A, 5kkq_D, 5ei9_F, 6wmi_A, 8ssq_A, 5und_A, 4m9v_C, 2lt7_A, 1tf6_A, 2i13_A, 6a57_A, 5yel_A, 7n5w_A, 5k5l_F, 6ml4_A, 4x9j_A, 8gn3_A, 6blw_A, 2drp_D, 1f2i_J, 5k5i_A, 2gli_A, 8h9h_G, 7eyi_G, 6e94_A, 7ysf_A, 2jpa_A, 1ubd_C, 7y3l_A, 3uk3_C, 1tf3_A, 8cuc_F, 1llm_D, 6u9q_A, 1mey_C, 7txc_E, 5kl3_A, 1g2f_F, 7y3m_I, 2wbs_A, 5yj3_D |
| Binding Motifs: | UN0219.1 mGcTTTTCCCACam UN0340.1 svrCCGGAAGTGrcgsss MA2097.1 GcTTTTCCCACa UN0340.2 CCGGAAGTG |
| Binding Sites: | UN0340.1.1 UN0340.1.14 UN0340.1.15 UN0340.1.16 UN0340.1.17 UN0340.1.19 UN0340.1.2 UN0340.1.3 UN0340.1.3 / UN0340.1.6 UN0340.1.4 / UN0340.1.7 UN0340.1.10 UN0340.1.11 UN0340.1.12 / UN0340.1.6 UN0340.1.13 UN0340.1.14 / UN0340.1.7 UN0340.1.15 / UN0340.1.16 / UN0340.1.8 / UN0340.1.9 UN0340.1.10 / UN0340.1.17 UN0340.1.11 / UN0340.1.12 / UN0340.1.18 / UN0340.1.19 UN0340.1.13 / UN0340.1.20 UN0340.1.2 / UN0340.1.4 UN0340.1.5 UN0340.1.5 / UN0340.1.8 UN0340.1.9 UN0340.1.18 UN0340.1.20 UN0340.2.1 / UN0340.2.11 / UN0340.2.12 / UN0340.2.7 UN0340.2.2 UN0340.2.19 UN0340.2.10 / UN0340.2.16 / UN0340.2.8 / UN0340.2.9 UN0340.2.13 UN0340.2.14 UN0340.2.15 UN0340.2.17 / UN0340.2.20 UN0340.2.18 UN0340.2.3 / UN0340.2.4 / UN0340.2.5 UN0340.2.6 |
| Publications: | Venkataraman A, Yang K, Irizarry J, Mackiewicz M, Mita P, Kuang Z, Xue L, Ghosh D, Liu S, Ramos P, Hu S, Bayron Kain D, Keegan S, Saul R, Colantonio S, Zhang H, Behn FP, Song G, Albino E, Asencio L, Ramos L, Lugo L, Morell G, Rivera J, Ruiz K, Almodovar R, Nazario L, Murphy K, Vargas I, Rivera-Pacheco ZA, Rosa C, Vargas M, McDade J, Clark BS, Yoo S, Khambadkone SG, de Melo J, Stevanovic M, Jiang L, Li Y, Yap WY, Jones B, Tandon A, Campbell E, Montelione GT, Anderson S, Myers RM, Boeke JD, Fenyo D, Whiteley G, Bader JS, Pino I, Eichinger DJ, Zhu H, Blackshaw S. A toolbox of immunoprecipitation-grade monoclonal antibodies to human transcription factors. Nat Methods 15:330-338 (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.