Transcription Factor
Accessions: | 2pi0_B (3D-footprint 20231221) |
Names: | Interferon regulatory factor 3, IRF-3, IRF3_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q14653 |
Length: | 112 |
Pfam Domains: | 7-111 Interferon regulatory factor transcription factor |
Sequence: (in bold interface residues) | 1 MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA 60 61 TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS |
Interface Residues: | 40, 42, 74, 78, 79, 81, 82, 85, 86 |
3D-footprint Homologues: | 2o61_A, 2pi0_B, 1if1_B, 2irf_L, 7oot_B |
Binding Motifs: | 2pi0_ABCD GGnAAACTGAAAGGGaGAnnTnAAAG 2pi0_B tTtC |
Binding Sites: | 2pi0_E 2pi0_F |
Publications: | Escalante C.R, Nistal-Villán E, Shen L, GarcÃa-Sastre A, Aggarwal A.K. Structure of IRF-3 bound to the PRDIII-I regulatory element of the human interferon-beta enhancer. Molecular cell 26:703-16 (2007). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.