Transcription Factor

Accessions: T044597_1.02 (CISBP 1.02)
Names: EGR3, T044597_1.02;
Organisms: Homo sapiens
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: family:C2H2 ZF
Length: 228
Pfam Domains: 116-140 C2H2-type zinc finger
116-140 Zinc finger, C2H2 type
133-156 Zinc-finger double domain
146-168 C2H2-type zinc finger
146-168 Zinc finger, C2H2 type
160-184 Zinc-finger double domain
174-194 C2H2-type zinc finger
174-196 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MDIGLTNEKPNPELSYSGSFQPAPGNKTVTMIPDYNLYHHPNDMGSIPEHKPFQGMDPIR 60
61 VNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPA 120
121 EGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCG 180
181 RKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA
Interface Residues: 98, 102, 105, 108, 111, 124, 128, 129, 130, 131, 132, 134, 135, 156, 157, 158, 159, 160, 162, 163, 164, 173, 184, 185, 186, 187, 188, 189, 190, 191, 192, 195
3D-footprint Homologues: 8ssq_A, 7w1m_H, 8ssu_A, 5kkq_D, 5ei9_F, 5v3j_F, 6blw_A, 4gnx_Z, 1tf3_A, 7n5w_A, 6jnm_A, 5kl3_A, 1ubd_C, 2kmk_A, 7ysf_A, 6ml4_A, 6u9q_A, 2gli_A, 1f2i_J, 2wbs_A, 1tf6_A, 4x9j_A, 2jpa_A, 1g2f_F, 8h9h_G, 2lt7_A, 6e94_A, 6a57_A, 3uk3_C, 8cuc_F, 7y3l_A, 7txc_E, 1llm_D, 2drp_D, 5k5i_A, 5yel_A, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D
Binding Motifs: M3178_1.02 vtGCGTrGGCGk
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.