Transcription Factor
| Accessions: | bZIP910 (Athamap 20091028), T028334_1.02 (CISBP 1.02), O22676 (JASPAR 2024) |
| Names: | bZIP910, O22676_ANTMA, T028334_1.02; |
| Organisms: | Antirrhinum majus |
| Libraries: | Athamap 20091028 1, CISBP 1.02 2, JASPAR 2024 3 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | family:bZIP |
| Length: | 133 |
| Pfam Domains: | 13-61 Basic region leucine zipper 17-75 bZIP transcription factor |
| Sequence: (in bold interface residues) | 1 MASQQRSTSPGIDDDERKRKRKLSNRESARRSRMRKQQRLDELIAQESQMQEDNKKLRDT 60 61 INGATQLYLNFASDNNVLRAQLAELTDRLHSLNSVLQIASEVSGLVLDIPDIPDALLEPW 120 121 QLPCPIQADIFQC |
| Interface Residues: | 21, 25, 26, 28, 29, 32, 33 |
| 3D-footprint Homologues: | 7x5e_E, 2dgc_A, 5t01_B, 1dh3_C |
| Binding Motifs: | bZIP910(1) GATGACGTGGCm bZIP910(2) GgrTGCTGACGT M2679_1.02 GATGACGTGGCm MA0096.1 mTGACGT |
| Binding Sites: | MA0096.1.1 / MA0096.1.10 / MA0096.1.12 / MA0096.1.14 / MA0096.1.3 / MA0096.1.5 / MA0096.1.8 MA0096.1.11 MA0096.1.13 / MA0096.1.2 / MA0096.1.4 / MA0096.1.6 / MA0096.1.7 / MA0096.1.9 MA0096.1.15 MA0096.1.16 / MA0096.1.18 MA0096.1.17 MA0096.1.19 MA0096.1.20 |
| Publications: | Martinez-Garcia J. F., Moyano E., Alcocer M. J. C., Martin C. Two bZIP proteins from Antirrhinum flowers preferentially bind a hybrid C-box/G-box motif and help to define a new sub-family of bZIP transcription factors.. Plant J. 13:489-505 (1998). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.