Transcription Factor
| Accessions: | ECK120005957 (RegulonDB 7.5) |
| Names: | NarP |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | ATP binding; sequence-specific DNA binding transcription factor activity; DNA binding; nucleotide binding; two-component signal transduction system (phosphorelay); intracellular; transcription, DNA-dependent; regulation of transcription, DNA-dependent; sequence-specific DNA binding; intracellular signal transduction; cytoplasm; anaerobic respiration; regulon; activator; two-component response regulator activity; two component regulatory systems (external signal); Transcription related; repressor |
| Length: | 216 |
| Pfam Domains: | 9-121 Response regulator receiver domain 152-207 Bacterial regulatory proteins, luxR family 159-194 Winged helix-turn-helix DNA-binding 167-196 Sigma-70, region 4 |
| Sequence: (in bold interface residues) | 1 MPEATPFQVMIVDDHPLMRRGVRQLLELDPGSEVVAEAGDGASAIDLANRLDIDVILLDL 60 61 NMKGMSGLDTLNALRRDGVTAQIIILTVSDASSDVFALIDAGADGYLLKDSDPEVLLEAI 120 121 RAGAKGSKVFSERVNQYLREREMFGAEEDPFSVLTERELDVLHELAQGLSNKQIASVLNI 180 181 SEQTVKVHIRNLLRKLNVRSRVAATILFLQQRGAQ* |
| Interface Residues: | 132, 171, 181, 182, 183, 184, 186, 187, 188, 189, 190 |
| 3D-footprint Homologues: | 4boc_A, 8u3b_G, 7ve5_B, 5w43_B, 7e1b_B, 4wuh_B, 1zlk_A |
| Binding Motifs: | NarP mTACyycT |
| Publications: | Unden G., Bongaerts J. Alternative respiratory pathways of Escherichia coli: energetics and transcriptional regulation in response to electron acceptors. Biochim Biophys Acta. 1320(3):217-34 (1997). [Pubmed] Stewart V., Bledsoe PJ. Fnr-, NarP- and NarL-dependent regulation of transcription initiation from the Haemophilus influenzae Rd napF (periplasmic nitrate reductase) promoter in Escherichia coli K-12. J Bacteriol. 187(20):6928-35 (2005). [Pubmed] Constantinidou C., Hobman JL., Griffiths L., Patel MD., Penn CW., Cole JA., Overton TW. A reassessment of the FNR regulon and transcriptomic analysis of the effects of nitrate, nitrite, NarXL, and NarQP as Escherichia coli K12 adapts from aerobic to anaerobic growth. J Biol Chem. 281(8):4802-15 (2006). [Pubmed] Gross R., Arico B., Rappuoli R. Families of bacterial signal-transducing proteins. Mol Microbiol. 3(11):1661-7 (1989). [Pubmed] Henikoff S., Wallace JC., Brown JP. Finding protein similarities with nucleotide sequence databases. Methods Enzymol. 183:111-32 (1990). [Pubmed] Stewart V. Biochemical Society Special Lecture. Nitrate- and nitrite-responsive sensors NarX and NarQ of proteobacteria. Biochem Soc Trans. 31(Pt 1):1-10 (2003). [Pubmed] Rabin RS., Stewart V. Dual response regulators (NarL and NarP) interact with dual sensors (NarX and NarQ) to control nitrate- and nitrite-regulated gene expression in Escherichia coli K-12. J Bacteriol. 175(11):3259-68 (1993). [Pubmed] Schroder I., Wolin CD., Cavicchioli R., Gunsalus RP. Phosphorylation and dephosphorylation of the NarQ, NarX, and NarL proteins of the nitrate-dependent two-component regulatory system of Escherichia coli. J Bacteriol. 176(16):4985-92 (1994). [Pubmed] Walker MS., DeMoss JA. Phosphorylation and dephosphorylation catalyzed in vitro by purified components of the nitrate sensing system, NarX and NarL. J Biol Chem. 268(12):8391-3 (1993). [Pubmed] Williams SB., Stewart V. Discrimination between structurally related ligands nitrate and nitrite controls autokinase activity of the NarX transmembrane signal transducer of Escherichia coli K-12. Mol Microbiol. 26(5):911-25 (1997). [Pubmed] Williams SB., Stewart V. Nitrate- and nitrite-sensing protein NarX of Escherichia coli K-12: mutational analysis of the amino-terminal tail and first transmembrane segment. J Bacteriol. 179(3):721-9 (1997). [Pubmed] Lee AI., Delgado A., Gunsalus RP. Signal-dependent phosphorylation of the membrane-bound NarX two-component sensor-transmitter protein of Escherichia coli: nitrate elicits a superior anion ligand response compared to nitrite. J Bacteriol. 181(17):5309-16 (1999). [Pubmed] Moreno-Vivian C., Cabello P., Martinez-Luque M., Blasco R., Castillo F. Prokaryotic nitrate reduction: molecular properties and functional distinction among bacterial nitrate reductases. J Bacteriol. 181(21):6573-84 (1999). [Pubmed] Baikalov I., Schroder I., Kaczor-Grzeskowiak M., Grzeskowiak K., Gunsalus RP., Dickerson RE. Structure of the Escherichia coli response regulator NarL. Biochemistry. 35(34):11053-61 (1996). [Pubmed] Baikalov I., Schroder I., Kaczor-Grzeskowiak M., Cascio D., Gunsalus RP., Dickerson RE. NarL dimerization? Suggestive evidence from a new crystal form. Biochemistry. 37(11):3665-76 (1998). [Pubmed] Lin AV., Stewart V. Functional roles for the GerE-family carboxyl-terminal domains of nitrate response regulators NarL and NarP of Escherichia coli K-12. Microbiology. 156(Pt 10):2933-43 (2010). [Pubmed] Tyson KL., Bell AI., Cole JA., Busby SJ. Definition of nitrite and nitrate response elements at the anaerobically inducible Escherichia coli nirB promoter: interactions between FNR and NarL. Mol Microbiol. 7(1):151-7 (1993). [Pubmed] Darwin AJ., Li J., Stewart V. Analysis of nitrate regulatory protein NarL-binding sites in the fdnG and narG operon control regions of Escherichia coli K-12. Mol Microbiol. 20(3):621-32 (1996). [Pubmed] Darwin AJ., Tyson KL., Busby SJ., Stewart V. Differential regulation by the homologous response regulators NarL and NarP of Escherichia coli K-12 depends on DNA binding site arrangement. Mol Microbiol. 25(3):583-95 (1997). [Pubmed] Tyson KL., Cole JA., Busby SJ. Nitrite and nitrate regulation at the promoters of two Escherichia coli operons encoding nitrite reductase: identification of common target heptamers for both NarP- and NarL-dependent regulation. Mol Microbiol. 13(6):1045-55 (1994). [Pubmed] Darwin AJ., Stewart V. Nitrate and nitrite regulation of the Fnr-dependent aeg-46.5 promoter of Escherichia coli K-12 is mediated by competition between homologous response regulators (NarL and NarP) for a common DNA-binding site. J Mol Biol. 251(1):15-29 (1995). [Pubmed] Browning DF., Lee DJ., Wolfe AJ., Cole JA., Busby SJ. The Escherichia coli K-12 NarL and NarP proteins insulate the nrf promoter from the effects of integration host factor. J Bacteriol. 188(21):7449-56 (2006). [Pubmed] Wu H., Tyson KL., Cole JA., Busby SJ. Regulation of transcription initiation at the Escherichia coli nir operon promoter: a new mechanism to account for co-dependence on two transcription factors. Mol Microbiol. 27(2):493-505 (1998). [Pubmed] Browning DF., Cole JA., Busby SJ. Suppression of FNR-dependent transcription activation at the Escherichia coli nir promoter by Fis, IHF and H-NS: modulation of transcription initiation by a complex nucleo-protein assembly. Mol Microbiol. 37(5):1258-69 (2000). [Pubmed] Lin HY., Bledsoe PJ., Stewart V. Activation of yeaR-yoaG Operon Transcription by Nitrate-responsive Regulator NarL is Independent of Oxygen-responsive Regulator Fnr in Escherichia coli K-12. J Bacteriol. 189(21):7539-48 (2007). [Pubmed] Squire DJ., Xu M., Cole JA., Busby SJ., Browning DF. Competition between NarL-dependent activation and Fis-dependent repression controls expression from the Escherichia coli yeaR and ogt promoters. Biochem J. 420(2):249-57 (2009). [Pubmed] Stewart V. Dual interacting two-component regulatory systems mediate nitrate- and nitrite-regulated gene expression in Escherichia coli. Res Microbiol. 145(5-6):450-4 (1994). [Pubmed] Overton TW., Griffiths L., Patel MD., Hobman JL., Penn CW., Cole JA., Constantinidou C. Microarray analysis of gene regulation by oxygen, nitrate, nitrite, FNR, NarL and NarP during anaerobic growth of Escherichia coli: new insights into microbial physiology. Biochem Soc Trans. 34(Pt 1):104-7 (2006). [Pubmed] Browning DF., Grainger DC., Beatty CM., Wolfe AJ., Cole JA., Busby SJ. Integration of three signals at the Escherichia coli nrf promoter: a role for Fis protein in catabolite repression. Mol Microbiol. 57(2):496-510 (2005). [Pubmed] Darwin AJ., Ziegelhoffer EC., Kiley PJ., Stewart V. Fnr, NarP, and NarL regulation of Escherichia coli K-12 napF (periplasmic nitrate reductase) operon transcription in vitro. J Bacteriol. 180(16):4192-8 (1998). [Pubmed] Partridge JD., Browning DF., Xu M., Newnham LJ., Scott C., Roberts RE., Poole RK., Green J. Characterization of the Escherichia coli K-12 ydhYVWXUT operon: regulation by FNR, NarL and NarP. Microbiology. 154(Pt 2):608-18 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.