Transcription Factor
Accessions: | 3dnv_B (3D-footprint 20231221), 4yg4_B (3D-footprint 20231221), 4yg7_C (3D-footprint 20231221), 4yg7_G (3D-footprint 20231221), 4z58_A (3D-footprint 20231221), 4z59_A (3D-footprint 20231221), 4z5c_A (3D-footprint 20231221), 4z5c_B (3D-footprint 20231221), 4z5d_A (3D-footprint 20231221), 4z5d_B (3D-footprint 20231221) |
Names: | HIPB_ECOLI, HTH-type transcriptional regulator hipB, Antitoxin HipB |
Organisms: | Escherichia coli, strain K12 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P23873 |
Length: | 71 |
Pfam Domains: | 9-64 Helix-turn-helix domain 9-62 Helix-turn-helix domain 13-64 Helix-turn-helix domain 15-66 Helix-turn-helix 19-64 Cro/C1-type HTH DNA-binding domain |
Sequence: (in bold interface residues) | 1 FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQS 60 61 LELSMTLCDAK |
Interface Residues: | 25, 26, 35, 36, 37, 38, 40, 41, 44, 47, 48 |
3D-footprint Homologues: | 3cro_R, 3oqm_C, 1per_L, 3zkc_A, 5k98_B, 3dnv_B, 4z5h_A, 4lln_I, 5gpc_B |
Binding Motifs: | 3dnv_AB / 3dnv_B TATc 4z58_A TATc 4z59_A TATc 4z5d_B tAtCC 4yg4_ABCD ATaCnnnnnnngGGA 4yg4_B TCCC 4yg7_BCDEGK TAnCCnnnnngGATAnnnnnnnnnnTAnnCCnnnnnGGGAT 4z5c_AB TATCCCnnnnnnCGGATA 4z5c_B TATCCC 4z5d_AB TAtCCrnnnnnnnGGwTA |
Binding Sites: | 3dnv_T 4yg4_F 4yg4_T 4yg7_R 4yg7_T 4z58_B 4z59_B 4z5c_C 4z5c_D 4z5d_C 4z5d_D |
Publications: | Schumacher M.A, Piro K.M, Xu W, Hansen S, Lewis K, Brennan R.G. Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB. Science (New York, N.Y.) 323:396-401 (2009). [Pubmed] Schumacher MA, Balani P, Min J, Chinnam NB, Hansen S, Vulić M, Lewis K, Brennan RG. HipBA-promoter structures reveal the basis of heritable multidrug tolerance. Nature 524:59-64 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.