Transcription Factor

Accessions: 2c6y_A (3D-footprint 20260701)
Names: FORKHEAD BOX PROTEIN K2, FOXK2_HUMAN, G/T-mismatch specific binding protein, Interleukin enhancer-binding factor 1, nGTBP
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q01167
Length: 98
Pfam Domains: 3-97 Fork head domain
Sequence:
(in bold interface residues)
1 DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRY 60
61 FIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR
Interface Residues: 26, 43, 45, 46, 48, 49, 50, 52, 53, 54, 56, 57, 66, 73, 94, 98
3D-footprint Homologues: 8vfz_O, 3l2c_A, 8bzm_E, 7vox_H, 2hdc_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 8sro_B, 3qrf_G
Binding Motifs: 2c6y_A TanTGTTTA
2c6y_AB TAAACAATACA
Binding Sites: 2c6y_C
2c6y_D
Publications: Tsai K.L, Huang C.Y, Chang C.H, Sun Y.J, Chuang W.J, Hsiao C.D. Crystal structure of the human FOXK1a-DNA complex and its implications on the diverse binding specificity of winged helix/forkhead proteins. The Journal of biological chemistry 281:17400-9 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.