Transcription Factor

Accessions: 5gzb_A (3D-footprint 20260701)
Names: TEA domain family member 4, TEAD-4, TEAD4_HUMAN, Transcription factor 13-like 1, Transcription factor RTEF-1, Transcriptional enhancer factor TEF-3
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q15561
Length: 91
Pfam Domains: 1-90 TEA/ATTS domain family
Sequence:
(in bold interface residues)
1 VWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSH 60
61 IQVLARRKAREIQAKLKDQAAKDKALQSMAA
Interface Residues: 33, 37, 54, 55, 58, 59, 62, 63, 66
3D-footprint Homologues: 5gzb_A, 5no6_N
Binding Motifs: 5gzb_A ATTCCtC
Binding Sites: 5gzb_B
5gzb_C
Publications: Shi Z, He F, Chen M, Hua L, Wang W, Jiao S, Zhou Z. DNA-binding mechanism of the Hippo pathway transcription factor TEAD4. Oncogene 36:4362-4369 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.