Transcription Factor
Accessions: | 5gzb_A (3D-footprint 20241219) |
Names: | TEA domain family member 4, TEAD-4, TEAD4_HUMAN, Transcription factor 13-like 1, Transcription factor RTEF-1, Transcriptional enhancer factor TEF-3 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q15561 |
Length: | 91 |
Pfam Domains: | 1-90 TEA/ATTS domain family |
Sequence: (in bold interface residues) | 1 VWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSH 60 61 IQVLARRKAREIQAKLKDQAAKDKALQSMAA |
Interface Residues: | 36, 38, 39, 42, 54, 55, 59, 62 |
3D-footprint Homologues: | 5v3j_F, 6qec_A |
Binding Motifs: | 5gzb_A ATTCCtC |
Binding Sites: | 5gzb_B 5gzb_C |
Publications: | Shi Z, He F, Chen M, Hua L, Wang W, Jiao S, Zhou Z. DNA-binding mechanism of the Hippo pathway transcription factor TEAD4. Oncogene 36:4362-4369 (2017). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.