Transcription Factor

						

			
Accessions: 6bz1_D (3D-footprint 20231221)

			
Names: MEF2 CHIMERA, MEF2A_HUMAN, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 87
Pfam Domains:      9-58 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence: 
(in bold interface residues)		   1 GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD   60
  61 MDKVLLKYTEYSEPHESRTNTVILETL
Interface Residues: 2, 3, 14, 17, 18, 22, 56, 67
3D-footprint Homologues: 1hbx_A, 1n6j_A, 1c7u_A, 7x1n_C, 1mnm_A, 7yq3_E
Binding Motifs: 6bz1_CD cTAnnnntAA
Binding Sites: 6bz1_G
6bz1_H
			
Publications: Lei X, Kou Y, Fu Y, Rajashekar N, Shi H, Wu F, Xu J, Luo Y, Chen L. The Cancer Mutation D83V Induces an α-Helix to β-Strand Conformation Switch in MEF2B. J Mol Biol 430:1157-1172 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.