Transcription Factor
Accessions: | P50553 (JASPAR 2024) |
Names: | Achaete-scute homolog 1, ASCL1_HUMAN, ASH-1, bHLHa46, Class A basic helix-loop-helix protein 46, hASH1 |
Organisms: | Homo sapiens |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | P50553 |
Length: | 236 |
Pfam Domains: | 122-171 Helix-loop-helix DNA-binding domain |
Sequence: (in bold interface residues) | 1 MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQ 60 61 QQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAV 120 121 ARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAV 180 181 SAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF |
Interface Residues: | 123, 124, 126, 127, 130, 131 |
3D-footprint Homologues: | 8ia3_B, 8osb_B, 7z5k_B |
Binding Motifs: | MA1100.2 rrCAGCTGcy MA1100.1 ssaGCAGCTGscs MA1631.1 cdgCACCTGCysc MA1100.3 rCAGCTGc MA1631.2 gCACCTGCy |
Binding Sites: | MA1100.1.1 MA1100.1.10 MA1100.1.11 / MA1100.1.8 MA1100.1.12 MA1100.1.13 MA1100.1.14 MA1100.1.15 MA1100.1.16 MA1100.1.17 MA1100.1.18 MA1100.1.19 MA1100.1.2 MA1100.1.20 MA1100.1.3 MA1100.1.4 MA1100.1.5 MA1100.1.6 MA1100.1.7 MA1100.1.9 MA1631.1.10 / MA1631.1.6 MA1631.2.14 MA1631.2.5 MA1631.2.7 MA1631.1.5 / MA1631.1.8 MA1631.1.1 MA1631.1.3 MA1631.1.11 / MA1631.1.7 MA1631.1.4 MA1631.1.6 MA1631.1.12 / MA1631.1.8 MA1631.1.13 / MA1631.1.9 MA1631.1.14 MA1631.1.10 / MA1631.1.15 MA1631.1.11 / MA1631.1.16 MA1631.1.12 / MA1631.1.17 MA1631.1.13 / MA1631.1.18 MA1631.1.14 / MA1631.1.19 MA1631.1.2 MA1631.1.15 / MA1631.1.20 MA1631.1.5 MA1631.1.7 MA1631.1.9 MA1631.1.19 MA1631.1.17 MA1631.1.20 MA1631.1.16 MA1631.1.18 MA1631.1.4 MA1631.2.1 MA1631.2.10 / MA1631.2.12 MA1631.2.11 MA1631.2.13 MA1631.2.15 / MA1631.2.16 / MA1631.2.19 / MA1631.2.3 / MA1631.2.9 MA1631.2.17 MA1631.2.18 MA1631.2.2 MA1631.2.20 MA1631.2.4 MA1631.2.6 MA1631.2.8 |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Aydin B, Kakumanu A, Rossillo M, Moreno-Estellés M, Garipler G, Ringstad N, Flames N, Mahony S, Mazzoni EO. Proneural factors Ascl1 and Neurog2 contribute to neuronal subtype identities by establishing distinct chromatin landscapes. Nat Neurosci 22:897-908 (2019). [Pubmed] Huang HS, Kubish GM, Redmond TM, Turner DL, Thompson RC, Murphy GG, Uhler MD. Direct transcriptional induction of Gadd45gamma by Ascl1 during neuronal differentiation. Mol Cell Neurosci 44:282-96 (2010). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.