Transcription Factor

Accessions: 1cf7_A (3D-footprint 20260701)
Names: E2F4_HUMAN, TRANSCRIPTION FACTOR E2F-4, Transcription factor E2F4
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q16254
Length: 67
Pfam Domains: 2-67 E2F/DP family winged-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKS 60
61 KNSIQWK
Interface Residues: 2, 39, 40, 41, 42, 44
3D-footprint Homologues: 1cf7_A, 4yo2_A, 1cf7_B
Binding Motifs: 1cf7_A tTcGCGCG
1cf7_AB TCGCGCG
Binding Sites: 1cf7_C
1cf7_D
Publications: Zheng N., Fraenkel E., Pabo C. O., Pavletich N. P. Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP. Genes Dev. 13:666-674 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.