Transcription Factor
| Accessions: | T24538 (AthalianaCistrome v4_May2016), Q9FH59 (JASPAR 2024) |
| Names: | AT5G66300, T24538;, VND3, ANAC105, NAC domain-containing protein 105, NC105_ARATH, Protein VASCULAR RELATED NAC-DOMAIN 3 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:NAC |
| Length: | 292 |
| Pfam Domains: | 13-139 No apical meristem (NAM) protein |
| Sequence: (in bold interface residues) | 1 MMKVDQDYSCSIPPGFRFHPTDEELVGYYLKKKIASQRIDLDVIREIDLYKIEPWDLQER 60 61 CRIGYEEQTEWYFFSHRDKKYPTGTRTNRATVAGFWKATGRDKAVYLNSKLIGMRKTLVF 120 121 YRGRAPNGQKSDWIIHEYYSLESHQNSPPQEEGWVVCRAFKKRTTIPTKRRQLWDPNCLF 180 181 YDDATLLEPLDKRARHNPDFTATPFKQELLSEASHVQDGDFGSMYLQCIDDDQFSQLPQL 240 241 ESPSLPSEITPHSTTFSENSSRKDDMSSEKRITDWRYLDKFVASQFLMSGED |
| Interface Residues: | 81, 86, 88, 97, 99, 101, 121, 125, 126, 127, 130 |
| 3D-footprint Homologues: | 7xp3_B, 3swp_A |
| Binding Motifs: | M0690 CkTraarwwsAAGCAA M0692 CkTraarwwsAAGCAAy MA2053.1 / UN0382.1 hwcAAGCAACcww MA2053.2 cAAGCAACc |
| Binding Sites: | UN0382.1.2 MA2053.1.6 / UN0382.1.9 MA2053.1.9 / UN0382.1.12 MA2053.1.2 / UN0382.1.3 MA2053.1.3 / UN0382.1.4 MA2053.1.4 / UN0382.1.5 MA2053.1.7 / UN0382.1.10 MA2053.1.8 / UN0382.1.11 UN0382.1.7 MA2053.1.1 / UN0382.1.1 MA2053.1.10 / UN0382.1.13 MA2053.1.11 / UN0382.1.14 MA2053.1.12 / UN0382.1.15 MA2053.1.13 / UN0382.1.16 MA2053.1.14 / UN0382.1.17 MA2053.1.15 / UN0382.1.18 MA2053.1.16 / UN0382.1.19 MA2053.1.17 / UN0382.1.20 UN0382.1.6 MA2053.1.5 / UN0382.1.8 MA2053.1.18 MA2053.1.19 MA2053.1.20 MA2053.2.14 MA2053.2.1 MA2053.2.10 MA2053.2.11 MA2053.2.12 MA2053.2.13 MA2053.2.15 MA2053.2.16 MA2053.2.17 MA2053.2.18 MA2053.2.19 MA2053.2.2 / MA2053.2.4 MA2053.2.20 MA2053.2.3 MA2053.2.5 MA2053.2.6 MA2053.2.7 MA2053.2.8 MA2053.2.9 |
| Publications: | Lindemose S, Jensen MK, Van de Velde J, O'Shea C, Heyndrickx KS, Workman CT, Vandepoele K, Skriver K, De Masi F. A DNA-binding-site landscape and regulatory network analysis for NAC transcription factors in Arabidopsis thaliana. Nucleic Acids Res 42:7681-93 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.