Transcription Factor
Accessions: | 2lkx_A (3D-footprint 20231221) |
Names: | ALL1-responsive protein ARP1, Homeobox protein PITX2, Paired-like homeodomain transcription factor 2, Pituitary homeobox 2, Pituitary homeobox 3, PITX2_HUMAN, RIEG bicoid-related homeobox transcription factor, Solurshin |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q99697 |
Length: | 68 |
Pfam Domains: | 4-60 Homeobox domain |
Sequence: (in bold interface residues) | 1 GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRK 60 61 REEFIVTD |
Interface Residues: | 4, 5, 6, 7, 9, 45, 46, 48, 49, 52, 53, 56, 57, 60 |
3D-footprint Homologues: | 1puf_A, 3cmy_A, 6a8r_A, 3d1n_M, 1fjl_B, 1ig7_A, 5zfz_A, 2h1k_B, 1jgg_B, 1nk2_P, 1zq3_P, 4j19_B, 6m3d_C, 3lnq_A, 2lkx_A, 2ld5_A, 5zjt_E, 2hdd_A, 1mnm_C, 7psx_B, 5hod_A, 3rkq_B, 2r5y_A, 1puf_B, 1au7_A, 2hos_A, 7q3o_C, 6es3_K, 1b72_A, 4xrs_G, 3l1p_A, 3a01_E, 5flv_I, 1le8_B, 5jlw_D, 1e3o_C, 2xsd_C, 1le8_A, 7xrc_C, 8g87_X, 4qtr_D, 1k61_B, 4xrm_B, 4cyc_A, 1o4x_A, 1du0_A |
Binding Motifs: | 2lkx_A GgATTAG |
Binding Sites: | 2lkx_B 2lkx_C |
Publications: | Chaney B.A, Clark-Baldwin K, Dave V, Ma J, Rance M. Solution structure of the K50 class homeodomain PITX2 bound to DNA and implications for mutations that cause Rieger syndrome. Biochemistry 44:7497-511 (2005). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.