Transcription Factor

Accessions: 1ic8_B (3D-footprint 20260701)
Names: HEPATOCYTE NUCLEAR FACTOR 1-ALPHA, HNF-1-alpha, HNF-1A, HNF1A_HUMAN, LFB1, Liver-specific transcription factor LF-B1, TCF-1, Transcription factor 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P20823
Length: 173
Pfam Domains: 1-92 Hepatocyte nuclear factor 1 (HNF-1), N terminus
96-168 Homeobox domain
Sequence:
(in bold interface residues)
1 ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHL 60
61 SQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHRNRFKWGPASQQILFQAYERQKNPS 120
121 KEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR
Interface Residues: 56, 57, 58, 59, 61, 62, 68, 69, 98, 158, 159, 160, 161, 164, 165, 168
3D-footprint Homologues: 2h8r_B, 8pi8_B, 4on0_B, 5zfz_A, 4j19_B, 1le8_A
Binding Motifs: 1ic8_AB GGTGArTTATtAACCAA
1ic8_B TTaATAnntcGCC
Binding Sites: 1ic8_E
1ic8_F
Publications: Chi Y.I, Frantz J.D, Oh B.C, Hansen L, Dhe-Paganon S, Shoelson S.E. Diabetes mutations delineate an atypical POU domain in HNF-1alpha. Molecular cell 10:1129-37 (2002). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.