Transcription Factor
Accessions: | 6blw_A (3D-footprint 20241219) |
Names: | Wilms tumor protein, WT1_HUMAN, WT33 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Length: | 109 |
Pfam Domains: | 9-31 C2H2-type zinc finger 23-50 Zinc-finger double domain 37-61 C2H2-type zinc finger 37-61 Zinc finger, C2H2 type 54-78 Zinc-finger double domain 67-89 Zinc finger, C2H2 type 67-89 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 HMEKRPFMCAYPGCNKRYFKLSHLQRHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRR 60 61 HTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKSCRWPSCQLVRHHNMHQ |
Interface Residues: | 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 32, 42, 49, 50, 51, 52, 53, 55, 56, 64, 65, 68, 76, 77, 78, 79, 80, 81, 83, 84, 90, 96, 100, 103, 104 |
3D-footprint Homologues: | 7n5w_A, 5v3j_F, 1tf3_A, 8ssu_A, 1ubd_C, 7w1m_H, 2kmk_A, 6u9q_A, 8ssq_A, 2gli_A, 8h9h_G, 1tf6_A, 7ysf_A, 6e94_A, 2lt7_A, 8hhl_A, 2jpa_A, 8cuc_F, 7y3l_A, 7txc_E, 2drp_D, 7y3m_I, 8gn3_A |
Binding Motifs: | 6blw_A GGGaGGGnt |
Binding Sites: | 6blw_B 6blw_C |
Publications: | Wang D, Horton JR, Zheng Y, Blumenthal RM, Zhang X, Cheng X. Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites. Nucleic Acids Res 46:3864-3877 (2018). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.