Transcription Factor

Accessions: 1zgw_A (3D-footprint 20260701)
Names: Ada polyprotein, ADA_ECOLI, Bifunctional transcriptional activator/DNA repair enzyme Ada, EC 2.1.1.63, EC 2.1.1.n11, Methylphosphotriester-DNA methyltransferase, O6-methylguanine-DNA alkyltransferase, Regulatory protein of adaptive response
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P06134
Length: 138
Pfam Domains: 10-74 Metal binding domain of Ada
97-132 Bacterial regulatory helix-turn-helix proteins, AraC family
104-137 Helix-turn-helix domain
Sequence:
(in bold interface residues)
1 MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFRPSCRARHALRENVSFYANASEA 60
61 LAAGFRPCKRCQPDKANPRQHRLDKITHACRLLEQETPVTLEALADQVAMSPFHLHRLFK 120
121 ATTGMTPKAWQQAWRARR
Interface Residues: 34, 43, 44, 70, 111, 113, 114, 116, 117, 120, 128
3D-footprint Homologues: 1zgw_A, 7vwz_G, 1xs9_A
Binding Motifs: 1zgw_A tTGCGnntTAAT
Binding Sites: 1zgw_B
1zgw_C
Publications: He C, Hus J.C, Sun L.J, Zhou P, Norman D.P, Dötsch V, Wei H, Gross J.D, Lane W.S, Wagner G, Verdine G.L. A methylation-dependent electrostatic switch controls DNA repair and transcriptional activation by E. coli ada. Molecular cell 20:117-29 (2005). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.