Transcription Factor

Accessions: T049481_1.02 (CISBP 1.02)
Names: T049481_1.02;, Zic3
Organisms: Mus musculus
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 246
Pfam Domains: 47-65 C2H2-type zinc finger
76-101 Zinc finger, C2H2 type
80-101 C2H2-type zinc finger
94-119 Zinc-finger double domain
107-131 Zinc finger, C2H2 type
107-131 C2H2-type zinc finger
123-150 Zinc-finger double domain
137-161 C2H2-type zinc finger
155-178 Zinc-finger double domain
167-189 Zinc finger, C2H2 type
167-187 Zinc-finger of C2H2 type
167-189 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIEEAQLSRPKKSCDRTFSTMHELVTH 60
61 VTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFAR 120
121 SENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPS 180
181 SLRKHMKVHESQGSDSSPAASSGYESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPN 240
241 FNEWYV
Interface Residues: 21, 22, 23, 53, 55, 56, 59, 89, 90, 91, 92, 93, 95, 96, 100, 107, 119, 120, 121, 122, 123, 125, 126, 128, 129, 132, 149, 150, 151, 152, 153, 154, 155, 156, 157, 160, 177, 178, 179, 180, 181, 182, 183, 184, 185
3D-footprint Homologues: 5v3j_F, 5yel_A, 1ubd_C, 7w1m_H, 8cuc_F, 1tf3_A, 7n5w_A, 1tf6_A, 5ei9_F, 6ml4_A, 8ssq_A, 8ssu_A, 5kkq_D, 4x9j_A, 2gli_A, 8h9h_G, 7ysf_A, 5k5i_A, 6e94_A, 2lt7_A, 8gn3_A, 2kmk_A, 3uk3_C, 7y3l_A, 6jnm_A, 7txc_E, 1g2f_F, 6blw_A, 1llm_D, 6u9q_A, 5kl3_A, 7y3m_I, 6a57_A, 2jpa_A, 2wbs_A, 5yj3_D, 1f2i_J, 4m9v_C, 2drp_D
Binding Motifs: M0441_1.02 crcagsrgGr
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.