Transcription Factor
| Accessions: | ZSCAN9 (HT-SELEX2 May2017) |
| Names: | ENSG00000137185, ZSCAN9 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
| Length: | 159 |
| Pfam Domains: | 19-39 C2H2-type zinc finger 19-41 Zinc finger, C2H2 type 19-41 C2H2-type zinc finger 34-58 Zinc-finger double domain 46-66 C2H2-type zinc finger 47-69 Zinc finger, C2H2 type 47-66 C2H2-type zinc finger 64-85 Zinc-finger double domain 75-97 C2H2-type zinc finger 75-97 Zinc finger, C2H2 type 75-97 C2H2-type zinc finger 90-113 Zinc-finger double domain 103-125 C2H2-type zinc finger 103-125 Zinc finger, C2H2 type 103-125 C2H2-type zinc finger 120-141 Zinc-finger double domain 130-151 C2H2-type zinc finger 131-153 Zinc finger, C2H2 type 131-153 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 EHKDRIERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGERPYECNECGKAFSRSS 60 61 GLFNHRGIHNIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQCSQCSKSYSRRSFLIE 120 121 HQRSHTGERPHQCIECGKSFNRHCNLIRHQKIHTVAELV |
| Interface Residues: | 5, 8, 29, 30, 31, 32, 33, 34, 35, 36, 38, 39, 40, 42, 47, 57, 58, 59, 60, 61, 63, 64, 68, 85, 86, 87, 88, 89, 92, 95, 96, 113, 114, 115, 116, 117, 119, 120, 121, 141, 142, 143, 144, 145, 146, 147, 148, 149 |
| 3D-footprint Homologues: | 8ssq_A, 5und_A, 8ssu_A, 3uk3_C, 8cuc_F, 7y3l_A, 5v3j_F, 6u9q_A, 5ei9_F, 6wmi_A, 5k5i_A, 7w1m_H, 2gli_A, 1tf6_A, 8gn3_A, 6blw_A, 5kkq_D, 7eyi_G, 7y3m_I, 6e94_A, 7ysf_A, 2i13_A, 5yel_A, 2jpa_A, 2kmk_A, 5yj3_D, 6ml4_A, 2lt7_A, 1ubd_C, 1tf3_A, 6jnm_A, 7n5w_A, 1mey_C, 7txc_E, 5kl3_A, 1f2i_J, 1g2f_F, 5k5l_F, 4x9j_A, 8h9h_G, 6a57_A, 2wbs_A, 2drp_D, 1llm_D, 4m9v_C |
| Binding Motifs: | ZSCAN9_2 rrgGATAAGATAAGAAtCay ZSCAN9_methyl_1 raGGATAAGATAAGAAkCay |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.