Transcription Factor

Accessions: 2lex_A (3D-footprint 20260701)
Names: Probable WRKY transcription factor 4, WRKY DNA-binding protein 4, WRKY4_ARATH
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9XI90
Length: 63
Pfam Domains: 2-60 WRKY DNA -binding domain
Sequence:
(in bold interface residues)
1 LLDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHD 60
61 LPA
Interface Residues: 9, 10, 11, 13, 14, 25, 52
3D-footprint Homologues: 6j4e_B, 6j4f_F, 6j4g_B, 6ir8_A, 7z0u_A, 8ejp_B
Binding Motifs: 2lex_A TnTnAC
Binding Sites: 2lex_B
2lex_C
Publications: Yamasaki K, Kigawa T, Watanabe S, Inoue M, Yamasaki T, Seki M, Shinozaki K, Yokoyama S. Structural basis for sequence-specific DNA recognition by an Arabidopsis WRKY transcription factor. The Journal of biological chemistry 287:7683-91 (2012). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.