Transcription Factor
| Accessions: | 2lex_A (3D-footprint 20260701) |
| Names: | Probable WRKY transcription factor 4, WRKY DNA-binding protein 4, WRKY4_ARATH |
| Organisms: | Arabidopsis thaliana |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9XI90 |
| Length: | 63 |
| Pfam Domains: | 2-60 WRKY DNA -binding domain |
| Sequence: (in bold interface residues) | 1 LLDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHD 60 61 LPA |
| Interface Residues: | 9, 10, 11, 13, 14, 25, 52 |
| 3D-footprint Homologues: | 6j4e_B, 6j4f_F, 6j4g_B, 6ir8_A, 7z0u_A, 8ejp_B |
| Binding Motifs: | 2lex_A TnTnAC |
| Binding Sites: | 2lex_B 2lex_C |
| Publications: | Yamasaki K, Kigawa T, Watanabe S, Inoue M, Yamasaki T, Seki M, Shinozaki K, Yokoyama S. Structural basis for sequence-specific DNA recognition by an Arabidopsis WRKY transcription factor. The Journal of biological chemistry 287:7683-91 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.