Transcription Factor

Accessions: 4ond_B (3D-footprint 20250804)
Names: Ancestral SR2 Helix Mutant
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 71
Pfam Domains: 2-69 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 KVCLICGDEASGCHYGVLTCEGCKAFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL 60
61 RKCLQAGMTLG
Interface Residues: 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 53
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A
Binding Motifs: 4ond_AB GGtnAnnnTGaCA
Binding Sites: 4ond_I
4ond_J
Publications: McKeown A.N, Bridgham J.T, Anderson D.W, Murphy M.N, Ortlund E.A, Thornton J.W. Evolution of DNA specificity in a transcription factor family produced a new gene regulatory module. Cell 159:58-68 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.