Transcription Factor

Accessions: HOXA1_DBD (HumanTF 1.0), HOXA1_TF2 (HumanTF2 1.0)
Names: Homeobox protein Hox-1F, Homeobox protein Hox-A1, HOXA1, HXA1_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: P49639
Notes: Ensembl ID: ENSG00000105991; DNA-binding domain sequence; TF family: homeodomain; Clone source: MGC, Ensembl ID: ENSG00000105991; Construct type: TF2(3xFLAG); TF family: Homeodomain; Clone source: Jolma et al. 2013
Length: 121
Pfam Domains: 37-90 Homeobox domain
Sequence:
(in bold interface residues)
1 MASSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTR 60
61 ARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSS 120
121 S
Interface Residues: 34, 35, 36, 37, 75, 76, 78, 79, 82, 83, 85, 86, 87, 90
3D-footprint Homologues: 8pmf_A, 1zq3_P, 2lkx_A, 6es3_K, 6m3d_C, 9b8u_A, 8ik5_C, 7psx_B, 2hdd_A, 8ejp_B, 4cyc_A, 8osb_E, 7q3o_C, 2hos_A, 8eml_B, 2ld5_A, 7xrc_C, 8bx1_A, 8g87_X
Binding Motifs: HOXA1_DBD rsyAATTArs
ELK1_HOXA1_1 aCCGGAAGTAAtTa
ELK1_HOXA1_2 rCCGGAAGTvaTya
PBX4_HOXA1 vymATmAATCA-
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.