Transcription Factor

						

			
Accessions: 4u0y_A (3D-footprint 20231221), 4u0y_B (3D-footprint 20231221), 4u0y_C (3D-footprint 20231221)

			
Names: HTH-type transcriptional repressor NagR, HTH-type transcriptional repressor YvoA, N-acetylglucosamine utilization regulator, NAGR_BACSU
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O34817
Length: 75
Pfam Domains:     12-74 Bacterial regulatory proteins, gntR family
    39-73 DeoR-like helix-turn-helix domain
Sequence: 
(in bold interface residues)		   1 MNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVN   60
  61 EGLLYRLKGRGTFVS
Interface Residues: 12, 36, 37, 38, 41, 47, 48, 49, 50, 51, 52, 53, 56, 68, 69
3D-footprint Homologues: 7zla_B, 6wg7_G, 4h0e_A, 4wwc_B, 4p9u_F, 4u0y_B, 1h9t_B, 6za3_B, 4i2o_B, 3wgi_D
Binding Motifs: 4u0y_ABCD GTGGycTAgaCCAC
4u0y_B TGGyaTA
Binding Sites: 4u0y_E / 4u0y_F
			
Publications: Fillenberg S.B, Grau F.C, Seidel G, Muller Y.A. Structural insight into operator dre-sites recognition and effector binding in the GntR/HutC transcription regulator NagR. Nucleic acids research 43:1283-96 (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.