Transcription Factor

Accessions: ISX_DBD (HumanTF 1.0), ISX (HT-SELEX2 May2017)
Names: Intestine-specific homeobox, ISX, ISX_HUMAN, RAX-like homeobox, ENSG00000175329
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q2M1V0
Notes: Ensembl ID: ENSG00000175329; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 110
Pfam Domains: 26-82 Homeobox domain
Sequence:
(in bold interface residues)
1 GEAAASGSGLEKPPKDQPQEGRKSKRRVRTTFTTEQLHELEKIFHFTHYPDVHIRSQLAA 60
61 RINLPEARVQIWFQNQRAKWRKQEKIGNLGAPQQLSEASVALPTNLDVAG
Interface Residues: 13, 15, 16, 17, 19, 24, 26, 27, 28, 29, 35, 67, 68, 70, 71, 74, 75, 77, 78, 79, 81, 82
3D-footprint Homologues: 6dnw_A, 3cmy_A, 1puf_A, 3d1n_M, 8ejp_B, 6a8r_A, 1fjl_B, 8pmf_A, 1ig7_A, 5zfz_A, 2lkx_A, 1jgg_B, 6m3d_C, 3lnq_A, 1nk2_P, 1zq3_P, 6es3_K, 2ld5_A, 7q3o_C, 3rkq_B, 5flv_I, 9b8u_A, 2hdd_A, 5zjt_E, 4cyc_A, 2r5y_A, 8ik5_C, 5hod_A, 2hos_A, 1au7_A, 8osb_E, 1puf_B, 7psx_B, 5jlw_D, 8eml_B, 1b72_A, 4xrs_G, 3a01_E, 1e3o_C, 1le8_A, 2xsd_C, 8g87_X, 1o4x_A, 1du0_A, 8bx1_A, 4qtr_D
Binding Motifs: ISX_DBD_1 yTAATyTAATTAr
ISX_DBD_2 cyAATTAr
ISX_3 CYAATTAa
ISX_6 CYAATTAr
ISX_methyl_1 CTAATTAa
ISX_methyl_2 ctCrTTAa
ISX_methyl_4 cYAATTAr
ISX_methyl_5 ctCrTTAa
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.