Transcription Factor

Accessions: T049269_1.02 (CISBP 1.02), Q6NZQ6 (JASPAR 2024)
Names: T049269_1.02;, Zfp740, ZN740_MOUSE
Organisms: Mus musculus
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q6NZQ6
Notes: experiment type:PBM, family:C2H2 ZF
Length: 180
Pfam Domains: 88-110 C2H2-type zinc finger
102-125 Zinc-finger double domain
116-138 C2H2-type zinc finger
116-138 Zinc finger, C2H2 type
130-154 Zinc-finger double domain
144-165 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MMLSQIASKQAENGERAGSPDVLRCSSQMDCKPRFDLSSKGHRKDSDKSRNRKEDDSLAE 60
61 ASHSKKTVKKVVVVEQNGSFQVKIPKNFICEHCFGAFRSSYHLKRHVLIHTGEKPFECDV 120
121 CDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQGCQSKTSEGQFSL 180
Interface Residues: 88, 98, 99, 100, 101, 102, 104, 105, 107, 108, 111, 126, 127, 128, 129, 130, 132, 133, 134, 155, 156, 157, 158, 159, 160, 161, 162
3D-footprint Homologues: 2kmk_A, 5v3j_F, 3uk3_C, 8cuc_F, 7y3l_A, 1tf3_A, 7n5w_A, 6jnm_A, 1g2f_F, 7ysf_A, 6ml4_A, 1ubd_C, 8ssq_A, 7w1m_H, 6blw_A, 6u9q_A, 8ssu_A, 5kkq_D, 8gn3_A, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 8h9h_G, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 2jpa_A, 5k5i_A, 1llm_D, 5yel_A, 2drp_D, 5yj3_D, 1f2i_J, 2wbs_A, 7txc_E, 4m9v_C
Binding Motifs: PB0100.1 ycyccCCCCCCmmwys
PB0204.1 rrrtwCCCCCCggrrry
M0429_1.02 wrtGGGGGGg
M0430_1.02 mrtGGGGGgg
Publications: Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.