Transcription Factor

Accessions: 5t7x_A (3D-footprint 20231221)
Names: EBNA-1, EBNA1_EBVG, EBV nuclear antigen 1, Epstein-Barr nuclear antigen 1
Organisms: Epstein-Barr virus (strain GD1) (HHV-4), Human herpesvirus 4
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q3KSS4
Length: 147
Pfam Domains: 1-146 Epstein Barr virus nuclear antigen-1, DNA-binding domain
Sequence:
(in bold interface residues)
1 KGGWFGKHRGQGGSNPKFENIAEGLRVLLARSHVERTTEEGNWVAGVFVYGGSKTSLYNL 60
61 RRGIALAVPQCRITPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIK 120
121 DLVMIKPAPTCNIKVTVCSFDDGVDLP
Interface Residues: 1, 4, 5, 9, 17, 54, 55, 58, 59, 62
3D-footprint Homologues: 5t7x_B, 7u1t_B
Binding Motifs: 5t7x_AB GGATAGCnnntGcTACCC
Publications: Dheekollu J, Malecka K, Wiedmer A, Delecluse HJ, Chiang AK, Altieri DC, Messick TE, Lieberman PM. Carcinoma-risk variant of EBNA1 deregulates Epstein-Barr Virus episomal latency. Oncotarget 8:7248-7264 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.