Transcription Factor

Accessions: T015228_1.02 (CISBP 1.02), P70660 (JASPAR 2024)
Names: Neurog1, T015228_1.02;, Helix-loop-helix protein mATH-4C, mATH4C, NeuroD3, Neurogenic basic-helix-loop-helix protein, Neurogenic differentiation factor 3, Neurogenin-1, NGN-1, NGN1_MOUSE
Organisms: Mus musculus
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:bHLH
Length: 244
Pfam Domains: 94-145 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MPAPLETCISDLDCSSSNSSSDLSSFLTDEEDCARLQPLASTSGLSVPARRSAPALSGAS 60
61 NVPGAQDEEQERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVL 120
121 PSFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGSARERLLPPQCVPCLPGPPSP 180
181 ASDTESWGSGAAASPCATVASPLSDPSSPSASEDFTYGPGDPLFSFPGLPKDLLHTTPCF 240
241 IPYH
Interface Residues: 95, 98, 99, 101, 102, 103, 105, 106, 115, 118, 119, 121, 122, 131
3D-footprint Homologues: 7z5k_B, 2ypa_A, 8osb_B, 7ssa_L, 6od3_F, 4h10_B, 2ql2_D, 2ypa_B, 5gnj_I, 4iri_A
Binding Motifs: M0217_1.02 acMaTATGky
MA0623.1 acMaTATGky
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.