Transcription Factor

Accessions: 3g73_B (3D-footprint 20241219)
Names: Forkhead box protein M1, Forkhead-related protein FKHL16, FOXM1_HUMAN, Hepatocyte nuclear factor 3 forkhead homolog 11, HFH-11, HNF-3/fork-head homolog 11, M-phase phosphoprotein 2, MPM-2 reactive phosphoprotein 2, Transcription factor Trident, Winged-helix factor from INS-1 cells
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q08050
Length: 95
Pfam Domains: 3-86 Fork head domain
Sequence:
(in bold interface residues)
1 SERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHD 60
61 MFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLD
Interface Residues: 26, 46, 47, 49, 50, 51, 53, 54, 55, 57, 58, 64, 71
3D-footprint Homologues: 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 7tdx_A, 2a07_J, 7yzb_A, 6el8_A, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 7yzg_A, 7tdw_A, 7yz7_A, 3g73_A, 8sro_B
Binding Motifs: 3g73_AB TgtTTATAAACA
Binding Sites: 3g73_C
3g73_D
Publications: Littler D.R, Alvarez-Fernández M, Stein A, Hibbert R.G, Heidebrecht T, Aloy P, Medema R.H, Perrakis A. Structure of the FoxM1 DNA-recognition domain bound to a promoter sequence. Nucleic acids research 38:4527-38 (2010). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.