Transcription Factor

Accessions: T037184_1.02 (CISBP 1.02)
Names: mnm-2, T037184_1.02;
Organisms: Caenorhabditis elegans
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 249
Pfam Domains: 164-179 Zinc-finger double domain
168-188 C2H2-type zinc finger
168-188 Zinc-finger of C2H2 type
168-190 Zinc finger, C2H2 type
168-190 C2H2-type zinc finger
185-206 Zinc-finger double domain
196-218 Zinc finger, C2H2 type
196-218 C2H2-type zinc finger
196-206 C2H2-type zinc finger
210-234 Zinc-finger double domain
224-246 C2H2-type zinc finger
224-246 Zinc finger, C2H2 type
224-246 Zinc-finger of C2H2 type
224-246 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MSVEASRTCFLIDSLLNKKPKEELETEEEDEEEDEEEELSSSEVTSENDMETESASSSAS 60
61 SVGQPKPDFSAFHKIFSNLDFAKLAAVKRNGHHQPMLFRPECFFPLELSKHLHLVQQTFQ 120
121 MNVLQNLGHTLPLPFVPMLKNVAPAQKRLNNKRASYVDHSQKGNLKKYRCDVCDKTFSRS 180
181 NTLITHKRIHTGEKPFKCEHCGRAFRQPGNLTRHRLTHTTVKPYVCGLCDKAFNRASNLH 240
241 THMRTHTNV
Interface Residues: 118, 121, 145, 146, 147, 148, 150, 151, 154, 168, 178, 179, 180, 181, 182, 184, 185, 187, 188, 189, 191, 205, 206, 207, 208, 209, 210, 212, 213, 214, 217, 234, 235, 236, 237, 238, 239, 240, 241, 242, 244, 245
3D-footprint Homologues: 8ssq_A, 7w1m_H, 5yel_A, 8ssu_A, 7ysf_A, 2lt7_A, 2kmk_A, 7n5w_A, 6jnm_A, 3uk3_C, 6ml4_A, 1tf3_A, 8cuc_F, 7y3l_A, 5kkq_D, 1tf6_A, 5ei9_F, 1g2f_F, 5kl3_A, 1ubd_C, 5k5i_A, 1llm_D, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 2gli_A, 1f2i_J, 8h9h_G, 5v3j_F, 6e94_A, 7y3m_I, 6a57_A, 2jpa_A, 2wbs_A, 8gn3_A, 5yj3_D, 7txc_E, 2drp_D, 4m9v_C
Binding Motifs: M0381_1.02 arkgAwvyGy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.