Transcription Factor

Accessions: CG12029 (FlyZincFinger 1.0 )
Names: CG12029
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 117
Pfam Domains: 31-55 C2H2-type zinc finger
32-55 Zinc finger, C2H2 type
47-68 Zinc-finger double domain
61-85 Zinc finger, C2H2 type
61-85 C2H2-type zinc finger
78-101 Zinc-finger double domain
91-113 Zinc finger, C2H2 type
91-113 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 GTAAHIASLMSVRTVRYNRRNNPELEKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKP 60
61 YTCQWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSDHLALHMKRHLPKN
Interface Residues: 10, 11, 13, 16, 20, 35, 43, 44, 45, 46, 47, 49, 50, 51, 52, 53, 56, 73, 74, 75, 76, 77, 78, 79, 80, 81, 84, 101, 102, 103, 104, 105, 106, 107, 108, 112
3D-footprint Homologues: 8ssq_A, 7w1m_H, 5kkq_D, 8ssu_A, 6ar1_A, 1tf3_A, 6jnm_A, 5v3j_F, 6ml4_A, 7n5w_A, 3uk3_C, 5k5i_A, 2kmk_A, 2gli_A, 1g2f_F, 7eyi_G, 1tf6_A, 4x9j_A, 2i13_A, 6blw_A, 5kl3_A, 1ubd_C, 6u9q_A, 5ei9_F, 1mey_C, 5und_A, 7ysf_A, 6wmi_A, 4m9v_C, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 5yel_A, 8gn3_A, 1llm_D, 2wbs_A, 7txc_E, 2drp_D, 1f2i_J, 5yj3_D
Binding Motifs: CG12029_SANGER_10_FBgn0035454 gtGGGTGTGGY
CG12029_SOLEXA_5_FBgn0035454 krtGGGTGTGGYybk
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.