Transcription Factor

Accessions: PRRX2_full (HumanTF 1.0)
Names: Fragment, Predicted NUP98/PRRX2 fusion protein, PRRX2, Q5ISC7_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q5ISC7
Notes: Ensembl ID: ENSG00000167157; Full protein sequence; TF family: homeodomain; Clone source: hORFeome
Length: 254
Pfam Domains: 105-161 Homeobox domain
227-245 OAR domain
Sequence:
(in bold interface residues)
1 MDSAAAAFALDKPALGPGPPPPPPALGPGDCAQARKNFSVSHLLDLEEVAAAGRLAARPG 60
61 ARAEAREGAAREPSGGSSGSEAAPQDGECPSPGRGSAAKRKKKQRRNRTTFNSSQLQALE 120
121 RVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQ 180
181 EAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAK 240
241 EFSLHHSQVPTVN*
Interface Residues: 105, 106, 107, 108, 146, 147, 149, 150, 153, 154, 156, 157, 158, 161
3D-footprint Homologues: 1puf_A, 3d1n_M, 1fjl_B, 8ejp_B, 6a8r_A, 1ig7_A, 3cmy_A, 8pmf_A, 5zfz_A, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 1jgg_B, 2ld5_A, 7q3o_C, 6es3_K, 2r5y_A, 6m3d_C, 5flv_I, 2hos_A, 9b8u_A, 1au7_A, 5zjt_E, 4j19_B, 1puf_B, 8ik5_C, 7psx_B, 5hod_A, 1b72_A, 3a01_E, 8osb_E, 5jlw_D, 3rkq_B, 8eml_B, 4xrs_G, 2hdd_A, 4cyc_A, 1e3o_C, 1le8_A, 2xsd_C, 7xrc_C, 8g87_X, 8bx1_A, 4qtr_D, 1o4x_A, 1du0_A
Binding Motifs: PRRX2_full yyAATTAr
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.