Transcription Factor
| Accessions: | 5t0u_A (3D-footprint 20260701) |
| Names: | 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P49711 |
| Length: | 170 |
| Pfam Domains: | 2-24 Zinc finger, C2H2 type 2-24 C2H2-type zinc finger 17-41 Zinc-finger double domain 30-53 Zinc finger, C2H2 type 30-53 C2H2-type zinc finger 45-68 Zinc-finger double domain 59-81 C2H2-type zinc finger 59-81 C2H2-type zinc-finger domain 74-95 Zinc-finger double domain 87-109 Zinc finger, C2H2 type 87-109 C2H2-type zinc finger 87-110 C2H2-type zinc-finger domain 102-126 Zinc-finger double domain 115-138 C2H2-type zinc finger 145-168 Zinc finger, C2H2 type 145-168 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 THKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFK 60 61 CSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYIC 120 121 HARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSY |
| Interface Residues: | 12, 13, 14, 15, 16, 18, 19, 40, 41, 42, 43, 44, 46, 47, 49, 50, 51, 54, 69, 70, 71, 72, 73, 76, 77, 94, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 112, 125, 126, 127, 128, 129, 131, 132, 133, 136, 156, 157, 158, 159, 162, 165 |
| 3D-footprint Homologues: | 7w1m_H, 2kmk_A, 5v3j_F, 2lt7_A, 6e94_A, 1ubd_C, 7n5w_A, 6jnm_A, 8ssu_A, 5kkq_D, 5yj3_D, 5ei9_F, 8ssq_A, 7ysf_A, 6a57_A, 2jpa_A, 7y3l_A, 1tf3_A, 1tf6_A, 6u9q_A, 4x9j_A, 2gli_A, 1g2f_F, 5kl3_A, 6ml4_A, 1f2i_J, 6blw_A, 8h9h_G, 4m9v_C, 8cuc_F, 3uk3_C, 2wbs_A, 8gn3_A, 1llm_D, 7txc_E, 5k5i_A, 7y3m_I, 1yuj_A, 2drp_D, 5yel_A, 5k5l_F |
| Binding Motifs: | 5t0u_A CaGCAGGGGGCGc |
| Binding Sites: | 5t0u_B 5t0u_C |
| Publications: | Hashimoto H, Wang D, Horton JR, Zhang X, Corces VG, Cheng X. Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA. Mol Cell 66:711-720 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.