Transcription Factor

Accessions: 5t0u_A (3D-footprint 20260701)
Names: 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P49711
Length: 170
Pfam Domains: 2-24 Zinc finger, C2H2 type
2-24 C2H2-type zinc finger
17-41 Zinc-finger double domain
30-53 Zinc finger, C2H2 type
30-53 C2H2-type zinc finger
45-68 Zinc-finger double domain
59-81 C2H2-type zinc finger
59-81 C2H2-type zinc-finger domain
74-95 Zinc-finger double domain
87-109 Zinc finger, C2H2 type
87-109 C2H2-type zinc finger
87-110 C2H2-type zinc-finger domain
102-126 Zinc-finger double domain
115-138 C2H2-type zinc finger
145-168 Zinc finger, C2H2 type
145-168 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 THKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFK 60
61 CSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYIC 120
121 HARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSY
Interface Residues: 12, 13, 14, 15, 16, 18, 19, 40, 41, 42, 43, 44, 46, 47, 49, 50, 51, 54, 69, 70, 71, 72, 73, 76, 77, 94, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 112, 125, 126, 127, 128, 129, 131, 132, 133, 136, 156, 157, 158, 159, 162, 165
3D-footprint Homologues: 7w1m_H, 2kmk_A, 5v3j_F, 2lt7_A, 6e94_A, 1ubd_C, 7n5w_A, 6jnm_A, 8ssu_A, 5kkq_D, 5yj3_D, 5ei9_F, 8ssq_A, 7ysf_A, 6a57_A, 2jpa_A, 7y3l_A, 1tf3_A, 1tf6_A, 6u9q_A, 4x9j_A, 2gli_A, 1g2f_F, 5kl3_A, 6ml4_A, 1f2i_J, 6blw_A, 8h9h_G, 4m9v_C, 8cuc_F, 3uk3_C, 2wbs_A, 8gn3_A, 1llm_D, 7txc_E, 5k5i_A, 7y3m_I, 1yuj_A, 2drp_D, 5yel_A, 5k5l_F
Binding Motifs: 5t0u_A CaGCAGGGGGCGc
Binding Sites: 5t0u_B
5t0u_C
Publications: Hashimoto H, Wang D, Horton JR, Zhang X, Corces VG, Cheng X. Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA. Mol Cell 66:711-720 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.