Transcription Factor

Accessions: BCL6B (HT-SELEX2 May2017)
Names: BCL6B, ENSG00000161940
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: BTB/POZ_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: BTB/POZ_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2
Length: 172
Pfam Domains: 20-43 C2H2-type zinc finger
21-43 Zinc finger, C2H2 type
21-43 C2H2-type zinc finger
35-59 Zinc-finger double domain
49-69 C2H2-type zinc finger
49-67 Zinc-finger of C2H2 type
49-60 C2H2-type zinc finger
49-71 Zinc finger, C2H2 type
63-87 Zinc-finger double domain
76-87 C2H2-type zinc finger
77-99 Zinc finger, C2H2 type
77-99 C2H2-type zinc finger
91-116 Zinc-finger double domain
105-127 Zinc finger, C2H2 type
105-127 C2H2-type zinc finger
105-120 C2H2-type zinc finger
120-143 Zinc-finger double domain
133-156 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 AVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSICGARFNR 60
61 PANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQTL 120
121 KSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP
Interface Residues: 7, 11, 31, 32, 33, 34, 35, 37, 38, 40, 41, 42, 44, 49, 59, 60, 61, 62, 63, 65, 66, 70, 87, 88, 89, 90, 91, 93, 94, 115, 116, 117, 118, 119, 121, 122, 123, 125, 143, 144, 145, 146, 147, 148, 149, 150, 151
3D-footprint Homologues: 7w1m_H, 7n5w_A, 7y3l_A, 5v3j_F, 2gli_A, 8gn3_A, 5kkq_D, 1llm_D, 6wmi_A, 8ssq_A, 5und_A, 8ssu_A, 8h9h_G, 7eyi_G, 7y3m_I, 2i13_A, 5yel_A, 2jpa_A, 1ubd_C, 2kmk_A, 6jnm_A, 8cuc_F, 1tf3_A, 1g2f_F, 6blw_A, 1tf6_A, 6u9q_A, 4x9j_A, 5kl3_A, 5ei9_F, 1mey_C, 1f2i_J, 5k5i_A, 6ml4_A, 2lt7_A, 6e94_A, 7ysf_A, 7txc_E, 5yj3_D, 2drp_D, 6a57_A, 3uk3_C, 2wbs_A, 4m9v_C
Binding Motifs: BCL6B_3 btGCTTTCkAGGAAtk
BCL6B_4 ryGYAATCGAGGAAtt
BCL6B_methyl_1 ytGCTTTCTAGGAAtt
BCL6B_methyl_2 rcGTAATCTAGGAAtt
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.